Dataset for protein Bmf of organism Calidris pygmaea

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C3KIN9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Calidris pygmaea GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
>gnl|bcl2dbpro|A0A8C3KIN9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Calidris pygmaea GN=BMF (length=196 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
VGCLWRGWWGFSSPGVVLWKTRSRHQLSRPLSKAAD
© 1998-2022Legal notice