Dataset for protein Bmf of organism Calidris pygmaea

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3KIN9_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8C3KIN9_BMF-02      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                       **************************************************

A0A8C3KIN9_BMF-01      LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8C3KIN9_BMF-02      LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                       **************************************************

A0A8C3KIN9_BMF-01      RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A8C3KIN9_BMF-02      RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
                       **************************************************

A0A8C3KIN9_BMF-01      DQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR-------
A0A8C3KIN9_BMF-02      DQFHRLHIQRV----GCLWRGWWGFSSPGVVLWKTRSRHQLSRPLSKAAD
                       **********     . :*.  : *    .:  ::. .*  .*       

© 1998-2022Legal notice