Dataset for protein classical BH3-containing proteins of organism Cairina moschata domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                           * .  
-akqppeakaqrgrqag---rlppaegpgpaaq--pgapaalpglpaaasfsssssssssspsssaaarpvs--sPpraq
m----------------ldd-------------lr-------------------------------------pgm eqtl
 mdr syleedyssld    dvfhsddf l g     emt tgiftqnq y cllgrfqlf lthccgpg r  h c qd
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .   .  :  .                                                                   
pppaspgpfatrsplfifvrrspllsrsssgyfsfeaerspapmscdkatqtpsppcq-------------------eei
rktqtlsrssvsq---------------------------------------------avshylsamasrwrshsla---
kas q a q saedvmlpcgvteepr lfy nagyrlhvp vgfal phl eepqeg                    q a
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      * :*. *.*:                     :   :     .:                               
qpeiwiAqeLrrIgDefnasycprr-----------vlflrllnlilrl---r-----i---------------------
-----c rk qc a qa--------qqnrnqvwwpqqirqfihsysinvvsp-tktnq-wrmqlrqvfrslkcrkgcagg
ra vq  l       k hrlhiq hgfld h gn  i i    hiaak fcnknhlghr kla                 
                                    d          h eak e                          

       250       260       270       280       290      
....:....|....:....|....:....|....:....|....:....|....:.
                                                        
--------------------------------------------------------
cihpgagacclrcgvvrccsvikrtqshqrvgtgdfqllqlcsqyqepvkhglllg
                                                        
                                                        
© 1998-2022Legal notice