Dataset for protein classical BH3-containing proteins of organism Cairina moschata domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3BLB7_PMAIP1-      --------------------------------------------------
A0A8C3GPS7_BMF-01       -MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQ--PGEMTATGIFTQNQS
A0A8C3BDR3_BCL2L11      MAKQPPEAKAQRGRQAG---RLPPAEGPGPAAQLRPGAPAALPGLPAAAS
A0A8C3BDR3_BCL2L11      MAKQPPEAKAQRGRQAG---RLPPAEGPGPAAQLRPGAPAALPGLPAAAS
                                                                          

A0A8C3BLB7_PMAIP1-      ------------------------MPCRTLRKSAQPARQAVAE-------
A0A8C3GPS7_BMF-01       YSCLLGRFQLFPLTHCCGPGVR--HPEQQDKATQTLSPSSSSQDVMLPCG
A0A8C3BDR3_BCL2L11      FSSSSSSSSSSPSSSAAARPVSPGSPPRAQPPPASPGPFATRSPLFIFVR
A0A8C3BDR3_BCL2L11      FSSSSSSSSSSPSSSAAARPVSPGSPPRAQPPPASPGPFATRSPLFIFVR
                                                 * .    .   .  :  .       

A0A8C3BLB7_PMAIP1-      --------------------------------------------------
A0A8C3GPS7_BMF-01       VTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQ------------
A0A8C3BDR3_BCL2L11      RSPLLSRSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASR
A0A8C3BDR3_BCL2L11      RSPLLSRSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASR
                                                                          

A0A8C3BLB7_PMAIP1-      ---------------CALELRRIGDKA-------------------DLRQ
A0A8C3GPS7_BMF-01       -------QEARAEVQIARKLQCIADQFHRLHIQRHQQNRNQVWW--QLFL
A0A8C3BDR3_BCL2L11      WRSHSLAEEIQPEIWIAQELRRIGDEFNASYCPRR-----------VIFL
A0A8C3BDR3_BCL2L11      WRSHSLAEEIQPEIWIAQELRRIGDEFNASYCPRRGFLDNHVGNPQIIIL
                                        * :*. *.*:                     :  

A0A8C3BLB7_PMAIP1-      RILNLIAKLFCPKT------------------------------------
A0A8C3GPS7_BMF-01       FLHNLALNVEANRNHTGQR-------------------------------
A0A8C3BDR3_BCL2L11      FLLSISLHLVSKREKLNHIWKLALRQVFRSLKCRKGCAGGCIHPGAGACC
A0A8C3BDR3_BCL2L11      RLLHYIIRL---------IWRMQ---------------------------
                         :     .:                                         

A0A8C3BLB7_PMAIP1-      ----------------------------------------------
A0A8C3GPS7_BMF-01       ----------------------------------------------
A0A8C3BDR3_BCL2L11      LRCGVVRCCSVIKRTQSHQRVGTGDFQLLQLCSQYQEPVKHGLLLG
A0A8C3BDR3_BCL2L11      ----------------------------------------------
                                                                      

© 1998-2022Legal notice