Dataset for protein classical BH3-containing proteins of organism Cairina moschata domestica

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C3BDR3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Cairina moschata domestica GN=BCL2L11 (length=282 residues).
MAKQPPEAKAQRGRQAGRLPPAEGPGPAAQLRPGAPAALPGLPAAASFSSSSSSSSSSPSSSAAARPVSPGSPPRAQPPP
ASPGPFATRSPLFIFVRRSPLLSRSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPE
IWIAQELRRIGDEFNASYCPRRVIFLFLLSISLHLVSKREKLNHIWKLALRQVFRSLKCRKGCAGGCIHPGAGACCLRCG
VVRCCSVIKRTQSHQRVGTGDFQLLQLCSQYQEPVKHGLLLG
>gnl|bcl2dbpro|A0A8C3BDR3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Cairina moschata domestica GN=BCL2L11 (length=211 residues).
MAKQPPEAKAQRGRQAGRLPPAEGPGPAAQLRPGAPAALPGLPAAASFSSSSSSSSSSPSSSAAARPVSPGSPPRAQPPP
ASPGPFATRSPLFIFVRRSPLLSRSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPE
IWIAQELRRIGDEFNASYCPRRGFLDNHVGNPQIIILRLLHYIIRLIWRMQ
>gnl|bcl2dbpro|A0A8C3BLB7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cairina moschata domestica GN=PMAIP1 (length=49 residues).
MPCRTLRKSAQPARQAVAECALELRRIGDKADLRQRILNLIAKLFCPKT
>gnl|bcl2dbpro|A0A8C3GPS7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cairina moschata domestica GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQR
© 1998-2022Legal notice