Dataset for protein Bim of organism Cairina moschata domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAKQPPEAKAQRGRQAGRLPPAEGPGPAAQLRPGAPAALPGLPAAASFSSSSSSSSSSPSSSAAARPVSPGSPPRAQPPP
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
ASPGPFATRSPLFIFVRRSPLLSRSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPE
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********************           :*:* **   :.*         **.:                     
IWIAQELRRIGDEFNASYCPRR-----------vIiLrLLsyslrL---------IWrmq--------------------
                      gfldnhvgnpqi f f  hiiih vskreklnh  klalrqvfrslkcrkgcaggcih

       250       260       270       280       290   
....:....|....:....|....:....|....:....|....:....|...
                                                     
-----------------------------------------------------
pgagacclrcgvvrccsvikrtqshqrvgtgdfqllqlcsqyqepvkhglllg
© 1998-2022Legal notice