Dataset for protein Bim of organism Cairina moschata domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3BDR3_BCL2L11      MAKQPPEAKAQRGRQAGRLPPAEGPGPAAQLRPGAPAALPGLPAAASFSS
A0A8C3BDR3_BCL2L11      MAKQPPEAKAQRGRQAGRLPPAEGPGPAAQLRPGAPAALPGLPAAASFSS
                        **************************************************

A0A8C3BDR3_BCL2L11      SSSSSSSSPSSSAAARPVSPGSPPRAQPPPASPGPFATRSPLFIFVRRSP
A0A8C3BDR3_BCL2L11      SSSSSSSSPSSSAAARPVSPGSPPRAQPPPASPGPFATRSPLFIFVRRSP
                        **************************************************

A0A8C3BDR3_BCL2L11      LLSRSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRS
A0A8C3BDR3_BCL2L11      LLSRSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRS
                        **************************************************

A0A8C3BDR3_BCL2L11      HSLAEEIQPEIWIAQELRRIGDEFNASYCPRRGFLDNHVGNPQIIILRLL
A0A8C3BDR3_BCL2L11      HSLAEEIQPEIWIAQELRRIGDEFNASYCPRR-----------VIFLFLL
                        ********************************           :*:* **

A0A8C3BDR3_BCL2L11      HYIIRL---------IWRMQ------------------------------
A0A8C3BDR3_BCL2L11      SISLHLVSKREKLNHIWKLALRQVFRSLKCRKGCAGGCIHPGAGACCLRC
                           :.*         **.:                               

A0A8C3BDR3_BCL2L11      -------------------------------------------
A0A8C3BDR3_BCL2L11      GVVRCCSVIKRTQSHQRVGTGDFQLLQLCSQYQEPVKHGLLLG
                                                                   

© 1998-2023Legal notice