Dataset for protein Bim of organism Cairina moschata domestica

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C3BDR3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Cairina moschata domestica GN=BCL2L11 (length=282 residues).
MAKQPPEAKAQRGRQAGRLPPAEGPGPAAQLRPGAPAALPGLPAAASFSSSSSSSSSSPSSSAAARPVSPGSPPRAQPPP
ASPGPFATRSPLFIFVRRSPLLSRSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPE
IWIAQELRRIGDEFNASYCPRRVIFLFLLSISLHLVSKREKLNHIWKLALRQVFRSLKCRKGCAGGCIHPGAGACCLRCG
VVRCCSVIKRTQSHQRVGTGDFQLLQLCSQYQEPVKHGLLLG
>gnl|bcl2dbpro|A0A8C3BDR3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Cairina moschata domestica GN=BCL2L11 (length=211 residues).
MAKQPPEAKAQRGRQAGRLPPAEGPGPAAQLRPGAPAALPGLPAAASFSSSSSSSSSSPSSSAAARPVSPGSPPRAQPPP
ASPGPFATRSPLFIFVRRSPLLSRSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPE
IWIAQELRRIGDEFNASYCPRRGFLDNHVGNPQIIILRLLHYIIRLIWRMQ
© 1998-2022Legal notice