Dataset for protein classical BH3-containing proteins of organism Bos mutus grunniens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mararqegsspepveglardgprpfplsrlvpsavscglvrptlpaaracpcqlpgaylcspwvppqiteflqsprwpss
                                       ceagae  p a al  a ff a tamhavraaegaeqedgg
                                                                 f  p           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 .    .. .                                      
-----------gqqpslsp---aeqhllspvpsspgarpggpt--a-g-------w-reigaqlrrmgddlnaryerrrs
prsrprgpspt-p------hwmtgrgqeqsavtartslaaaaeqa-p-vrgeeeq-a--------sqatrrqklsr---q
 ad gl  rmdk-psgv seclraprarkklqrp qrv  d  me l l       rvgvvtaptplqqkimf rpapm-
          a  a d  k  dp g   g  ep   l                    p cai    i  e  d qk  i 

       170       180       190      
....:....|....:....|....:....|....:.
               .                    
eerqrhrpsp--vlynlisgllpspgg-g-------
----------wr-tvghymsmmrfsy-r-apevepn
cfkststsa pcqas  hlkaagkqtrg dcacvga
ad g q      p f    d  a g           
© 1998-2022Legal notice