Dataset for protein classical BH3-containing proteins of organism Bos mutus grunniens

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9XQ92_PMAIP1-      --------------------------------------------------
A0A8B9YZT6_BCL2L11      --------------------------------------------------
A0A8C0AME3_BAD-01       --------------------------------------------------
A0A8B9XKZ1_BBC3-01      ---------------------------------------VRATAEAARAC
A0A8B9XKZ1_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
                                                                          

A0A8B9XQ92_PMAIP1-      --------------------------------------------------
A0A8B9YZT6_BCL2L11      ---------------------------------------MAKQPSDVSSE
A0A8C0AME3_BAD-01       --------------MFQIPEFEQSEQEDSSPADRGLGPSPTGQAPGLSKH
A0A8B9XKZ1_BBC3-01      PCQLPGAFF-SPWVPHQIR----------------------GPQPSLSP-
A0A8B9XKZ1_BBC3-02      PALLPAAYLCAPTAPPAVTAALGAPRWPGGPRSRPRGPRPDGPQPSLSP-
                                                                          

A0A8B9XQ92_PMAIP1-      -MPGRRARKSAQPSPTRVPADPE--------------VECAIQLRRIGDK
A0A8B9YZT6_BCL2L11      CDREGGQLQPAERPPQLRPGAPT----------------------SLQTE
A0A8C0AME3_BAD-01       WLTAPGLLGKLVTSRGSRPAAATMEALGL------WRPGVVTAPTPQGQR
A0A8B9XKZ1_BBC3-01      --AEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADD
A0A8B9XKZ1_BBC3-02      --AEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADD
                                     .    .. .                            

A0A8B9XQ92_PMAIP1-      LNFRQK-----------------LVNLISKLLRSGT----------
A0A8B9YZT6_BCL2L11      RQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQYRGGDCACVGA
A0A8C0AME3_BAD-01       IMKRRRRRISAFRGRSRSAP--PTSGLHSDMAASSGG---------
A0A8B9XKZ1_BBC3-01      LNALYERRRQEERQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
A0A8B9XKZ1_BBC3-02      LNALYERRRQEERQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
                                                 .                    

© 1998-2022Legal notice