Dataset for protein classical BH3-containing proteins of organism Bos mutus grunniens

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8B9XKZ1_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Bos mutus grunniens GN=BBC3 (length=131 residues).
VRATAEAARACPCQLPGAFFSPWVPHQIRGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEERQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A8B9XKZ1_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Bos mutus grunniens GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEER
QRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A8B9XQ92_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Bos mutus grunniens GN=PMAIP1 (length=54 residues).
MPGRRARKSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
>gnl|bcl2dbpro|A0A8B9YZT6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGKQYRGGDC
ACVGA
>gnl|bcl2dbpro|A0A8C0AME3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Bos mutus grunniens GN=BAD (length=115 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGQAPGLSKHWLTAPGLLGKLVTSRGSRPAAATMEALGLWRPGVVTAPTPQGQR
IMKRRRRRISAFRGRSRSAPPTSGLHSDMAASSGG
© 1998-2022Legal notice