Dataset for protein classical BH3-containing proteins of organism Balaenoptera musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                          .   .                 
-------makqpsdvssecdreggqlqpaerp--------------------------pqlrp------gaplslqterq
mmpqpqh-er-eqe---p--------------fplsrlvpsavscglcepglpgpskmagttaarlkal---i-a-----
 cfpipev--s---gfq-eepvl rsrtgssa                     aapah arq       asy-h-rlmwr
  ec lcrgqlrpad   aagse paplrp                           a   l        ll gqpghqp
       f eg d       cga l gd d                               a        de ced fp 
          a                                                                a aa 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
g----------------------------------------------------------p---------k-tqtpsp---
-qpegegdrcpqgspqgplappaspgpfatrsplfifvrrssllsrsssgyfsfdtdrs-apmscsqed-s------pcq
antassshprwt gvrsrprg rpd                   tl rlslyplthedqeglspt   ethleslv ssp
svldcl ahggp a e                            p   hqf  ag ccg s r a    qee e   aa 
r   a                                                     e           a         
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------smrqsqavpadmrpeiwiaqe----lrrigdefnayyprrl-l---------------------------
afnhylsamatsgpqrsayppawetyrywrqpplsaqpmvewlh--frg--f-nnhqaaeghtqmvilrllrhiirlvwr
sqgvm pggvrrestsptrgvrlakvqwvldigaqfaarsakreqwwlqsvtqprskytrtrprpsqwpvwyrllqswlp
       carkgarr lpa slg asevgic       qc d agslk krnnllrasfqsgh  rps s anf mgl n
         lfe     f  n e  qcp a         a a   l g  qlecip legqa                  
          aa          d  e c                 e e   e   a e                      

       250   
....:....|...
             
-------------
mqrgrggpepsqn
rpl   a amep 
ln           
             
             
© 1998-2022Legal notice