Dataset for protein classical BH3-containing proteins of organism Balaenoptera musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                     *                          
------makqpsdvsse-----cdreggqlqpaer------------------P--pqlrpgapislqterq--------
mpqrrevesaeqertrpepveg-------------lvqsqvscplsrpqlpaa pavcvlsatrpg----aagnpegegd
 fppqcrkrsrlspgqg dg  pgtqppssptldlfap ald g celg f   athskhcql-l-srss--avtaal a
 egipafcqlqdhgf a     la gl rplsgs                    lg ecg  iy-tapgdpp        
        pc   d        a  d  p f                        d aae  ga c leakg        
        e                                                  c                    
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------t--ps-p-q-------a-as
rcpqgspqgplappaspgpfatrsplfifvrrssllsrsssgyfsfdtdrspapmscdks-qt--p-c-afnhyls-m--
prwp g rsrprg rpd                             hqqpqlssseqhtqspvvetrsrlvmyptgvtpe
                                                 g    a h lg ls as gahsglscqteeg
                                                          ge ga  a   gafg a  ad 
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            :                                   
mrqsqavpadmr-------peiwiaq----elrrigdefn--ayyprrlflrrq-aa-----------------------
------------srvvsdp-------rygaq---m---lhqr--wrq-v-ennhq--eshpqmviwrllrhiirlvwrmq
vqtefye sppkgcsraa ensaarrltar-fka-s k--  tsfkgq-ws--akytsgpttywqlpvwarqvqsllpwp
pgrleea  ef         lq qpe i  r   la d    gm eekrtqps-rsrrtl   rpslsaynllmgwanrn
e g                  l                    cl    ernlqsplppag       c  af aa  all
                                           e    aqgelpahfg a                    
                                                 l ci                           
                                                 e                              

       250 
....:....|.
           
-----------
lgrgnpepsqn
r  rglamep 
    a      
           
           
           
           
© 1998-2023Legal notice