Dataset for protein classical BH3-containing proteins of organism Balaenoptera musculus

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A8B8Y772_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Balaenoptera musculus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGPSKHPQTAPGLLGEAGHQQGQPASSSHHGGTGAVETRSRHSFYSAGT
EDEEGTEEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHGSFKGLPRPKSAGTATQMRQSPSWARFLQSWWNRNLG
RGGPAPSQ
>gnl|bcl2dbpro|A0A8B8Z6B1_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A8B8Z6B1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ
>gnl|bcl2dbpro|A0A8B8Z6B1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ
>gnl|bcl2dbpro|A0A8B8Z6B1_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Balaenoptera musculus GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLT
ECLAAYT
>gnl|bcl2dbpro|A0A8B8Z7R2_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Balaenoptera musculus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A8C0CL26_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Balaenoptera musculus GN=BMF (length=129 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLSAQPRCEWREQEWGRSQ
>gnl|bcl2dbpro|A0A8C0D9H2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Balaenoptera musculus GN=PMAIP1 (length=54 residues).
MPGRRARKSAQQSPTRAPADPEVECAIQFRRIGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|A0A8C0I683_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Balaenoptera musculus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
© 1998-2022Legal notice