Dataset for protein classical BH3-containing proteins of organism Balaenoptera musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0D9H2_PMAIP1-      MPGRRARKSAQQSPTRA---------------------------------
A0A8C0CL26_BMF-01       MEPPQCVEELEDDVFQPEDGE-PGTQPGSLLSADLFAQSQLDCPLSRLQL
A0A8B8Z7R2_HRK-01       ------MCPCPLHRGRG---------------------------------
A0A8C0I683_BBC3-01      ------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGL
A0A8B8Y772_BAD-01       MFQIPEFEQSEQEDSSP-----ADRGLGPSPTGDR---------------
A0A8B8Z6B1_BCL2L11      ------MAKQPSDVSSE-----CDREGGQLQPAER---------------
A0A8B8Z6B1_BCL2L11      ------MAKQPSDVSSE-----CDREGGQLQPAER---------------
A0A8B8Z6B1_BCL2L11      ------MAKQPSDVSSE-----CDREGGQLQPAER---------------
A0A8B8Z6B1_BCL2L11      ------MAKQPSDVSSE-----CDREGGQLQPAER---------------
                                                                          

A0A8C0D9H2_PMAIP1-      ---PADPEVECAI-------------------------------------
A0A8C0CL26_BMF-01       F--PLTHCCGPGLRPTSQEDKA----------------------------
A0A8B8Z7R2_HRK-01       ---PPAVCACSAGRLGLRSSAA----------------------------
A0A8C0I683_BBC3-01      PAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGGPRSRPRGPRPDGP-
A0A8B8Y772_BAD-01       ---PPGPSKHPQTAPGLLGEAG----------------------------
A0A8B8Z6B1_BCL2L11      ---P--PQLRPGAPISLQTERQ----------------------------
A0A8B8Z6B1_BCL2L11      ---P--PQLRPGAPISLQTERQ----------------------------
A0A8B8Z6B1_BCL2L11      ---P--PQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPF
A0A8B8Z6B1_BCL2L11      ---P--PQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPF
                           *                                              

A0A8C0D9H2_PMAIP1-      --------------------------------------------------
A0A8C0CL26_BMF-01       --------------------------------------TQTLSPASPSQG
A0A8B8Z7R2_HRK-01       --------------------------------------------------
A0A8C0I683_BBC3-01      ----------------------------QPSLSPAEQHLESPVPSAPGAL
A0A8B8Y772_BAD-01       --------------------------HQQGQPASSSHHGGTGAVETRSRH
A0A8B8Z6B1_BCL2L11      --------------------------------------------------
A0A8B8Z6B1_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPCQA
A0A8B8Z6B1_BCL2L11      ATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A8B8Z6B1_BCL2L11      ATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
                                                                          

A0A8C0D9H2_PMAIP1-      ----------------------------------------QFRRIGDKLN
A0A8C0CL26_BMF-01       VMLPCGVTEEPQRLFYAPAEPKSCVVADPPLSAQPR--------------
A0A8B8Z7R2_HRK-01       -----------------------------------QLTAARLKALGDELH
A0A8C0I683_BBC3-01      AGGPTQAAPGVRGE---------------EEQWARE-IGAQLRRMADDLN
A0A8B8Y772_BAD-01       SFYSAGTEDEEGTEEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFH
A0A8B8Z6B1_BCL2L11      --------ASMRQSQAVPADMR-------PEIWIAQ----ELRRIGDEFN
A0A8B8Z6B1_BCL2L11      FNHYLSAMASMRQSQAVPADMR-------PEIWIAQ----ELRRIGDEFN
A0A8B8Z6B1_BCL2L11      FNHYLSAMASMRQSQAVPADMR-------PEIWIAQ----ELRRIGDEFN
A0A8B8Z6B1_BCL2L11      FNHYLSAMASMRQSQAVPADMR-------PEIWIAQ----ELRRIGDEFN
                                                                          

A0A8C0D9H2_PMAIP1-      ----FRQKLLNLISKLFRSGT-----------------------------
A0A8C0CL26_BMF-01       --CEWREQEWGRSQ------------------------------------
A0A8B8Z7R2_HRK-01       QRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAALAAWLLGRRNL----
A0A8C0I683_BBC3-01      --ALYERRRQEEQQRHRPSP-----WRVLYNLIMGLLPLPRGRGAPEMEP
A0A8B8Y772_BAD-01       --GSFKG---LPRPKSAGTATQMRQSPSWARFLQSWWNRNLGRGGPAPSQ
A0A8B8Z6B1_BCL2L11      --AYYPRRLTECLAAYT---------------------------------
A0A8B8Z6B1_BCL2L11      --AYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ----------
A0A8B8Z6B1_BCL2L11      --AYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ----------
A0A8B8Z6B1_BCL2L11      --AYYPRRLEQ---------------------------------------
                            :                                             

A0A8C0D9H2_PMAIP1-      -
A0A8C0CL26_BMF-01       -
A0A8B8Z7R2_HRK-01       -
A0A8C0I683_BBC3-01      N
A0A8B8Y772_BAD-01       -
A0A8B8Z6B1_BCL2L11      -
A0A8B8Z6B1_BCL2L11      -
A0A8B8Z6B1_BCL2L11      -
A0A8B8Z6B1_BCL2L11      -
                         

© 1998-2023Legal notice