Dataset for protein classical BH3-containing proteins of organism Balaenoptera musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0D9H2_PMAIP1-      --------------------------------------------------
A0A8B8Z6B1_BCL2L11      -------MAKQPSDVSSECDREGGQLQPAERP------------------
A0A8B8Z7R2_HRK-01       MCPCPLHRGRGPPAV---CACSAGRLGLRSSA------------------
A0A8C0CL26_BMF-01       -MEPPQCVEELEDDVFQPEDGE----------------------------
A0A8C0I683_BBC3-01      -------MARARQEGSSP-EPVEGLARDGPRPFPLSRLVPSAVSCGLCEP
A0A8B8Y772_BAD-01       -MFQIPEFEQSEQEDSSPADRGLGPSPTGDRP------------------
A0A8B8Z6B1_BCL2L11      -------MAKQPSDVSSECDREGGQLQPAERP------------------
A0A8B8Z6B1_BCL2L11      -------MAKQPSDVSSECDREGGQLQPAERP------------------
A0A8B8Z6B1_BCL2L11      -------MAKQPSDVSSECDREGGQLQPAERP------------------
                                                                          

A0A8C0D9H2_PMAIP1-      -------MPGRRA-------------------------------------
A0A8B8Z6B1_BCL2L11      --------PQLRP------GAPISLQTERQA-------------------
A0A8B8Z7R2_HRK-01       --------AQLTAARLKALGDELHQRTMWRR-------------------
A0A8C0CL26_BMF-01       --------PGTQP------GSLLSADLFAQSQLDC---------------
A0A8C0I683_BBC3-01      GLPAAPAAPALLP------AAYLCAPTAPPAVTAALGAPRWPGGPRSRPR
A0A8B8Y772_BAD-01       --PGPSKHPQTAP------GL-LGEAGHQQGQPASSSHHGGTGAVE----
A0A8B8Z6B1_BCL2L11      --------PQLRP------GAPISLQTERQ--------------------
A0A8B8Z6B1_BCL2L11      --------PQLRP------GAPISLQTERQGNPEGEGDRCPQGSPQGPLA
A0A8B8Z6B1_BCL2L11      --------PQLRP------GAPISLQTERQGNPEGEGDRCPQGSPQGPLA
                                .   .                                     

A0A8C0D9H2_PMAIP1-      --------------------------------------------------
A0A8B8Z6B1_BCL2L11      --------------------------------------------------
A0A8B8Z7R2_HRK-01       --------------------------------------------------
A0A8C0CL26_BMF-01       ------------------------PLSRLQLFPLTHCCGPGLRPTSQEDK
A0A8C0I683_BBC3-01      GPRPDGP-------------------------------QPSLSPA---EQ
A0A8B8Y772_BAD-01       ------------------------TRSRHSFYSAGTEDEEG--------T
A0A8B8Z6B1_BCL2L11      ------------------------------------DRSPAPMSC---DK
A0A8B8Z6B1_BCL2L11      PPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSC---DK
A0A8B8Z6B1_BCL2L11      PPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSC---DK
                                                                          

A0A8C0D9H2_PMAIP1-      -------------------RKSAQQSPTRAPADPEVECAIQ----FRRIG
A0A8B8Z6B1_BCL2L11      --------------------SMRQSQAVPADMRPEIWIAQE----LRRIG
A0A8B8Z7R2_HRK-01       --------------------RARSRRAPAPSALPTYWPWLC----AAAQV
A0A8C0CL26_BMF-01       ATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLSAQPRC
A0A8C0I683_BBC3-01      HLESPVPSA-------PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMA
A0A8B8Y772_BAD-01       EEEEPSP-------------FRGRSRSAPPNLWAAQRYGRE----LRRMS
A0A8B8Z6B1_BCL2L11      STQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQE----LRRIG
A0A8B8Z6B1_BCL2L11      STQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQE----LRRIG
A0A8B8Z6B1_BCL2L11      STQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQE----LRRIG
                                                                          

A0A8C0D9H2_PMAIP1-      DKLN--FRQKLLNLISKLFRSGT---------------------------
A0A8B8Z6B1_BCL2L11      DEFNAYYPRRLTECLAAYT-------------------------------
A0A8B8Z7R2_HRK-01       AALAAWLLGRRNL-------------------------------------
A0A8C0CL26_BMF-01       EWREQEWGRSQ---------------------------------------
A0A8C0I683_BBC3-01      DDLNALYERR-----RQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEM
A0A8B8Y772_BAD-01       DEFHGSFKG---LPRPKSAGTATQMRQSPSWARFLQSWWNRNLGRGGPAP
A0A8B8Z6B1_BCL2L11      DEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ--------
A0A8B8Z6B1_BCL2L11      DEFNAYYPRRLEQ-------------------------------------
A0A8B8Z6B1_BCL2L11      DEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ--------
                                                                          

A0A8C0D9H2_PMAIP1-      ---
A0A8B8Z6B1_BCL2L11      ---
A0A8B8Z7R2_HRK-01       ---
A0A8C0CL26_BMF-01       ---
A0A8C0I683_BBC3-01      EPN
A0A8B8Y772_BAD-01       SQ-
A0A8B8Z6B1_BCL2L11      ---
A0A8B8Z6B1_BCL2L11      ---
A0A8B8Z6B1_BCL2L11      ---
                           

© 1998-2022Legal notice