Dataset for protein classical BH3-containing proteins of organism Athene cunicularia

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mllsclscflkcpfiagamdrpsyleedyssldgldddvfhsddfglagqpgemtatgiftqnqsyscllgrfqlfplth
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    * :.                                               .:. .*   
---pg--h-------tsvlvPsss-----------------------------------------------reavaE--i
ccl--ir-prrqgwlgqtas faesqdvmlpcgvteeprrlfygnagyrlhvppvgfaldphlqeepregqkdvrp vwc
  g  hh keqcdka aq a                                                      q  iq 

       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
* :*. *.*::                       ..:  :   :*.                    
ArqLrrIgDqfnr----r----------------rqnrlnvlwkLflr------------------
 qk qc a kwhlsyiq-rvtfifllsislhmasqrkknqlwtq vcpltnlalnaeanrnhtgqr
 le      dalhcp h               e h      feh                
© 1998-2020Legal notice