Dataset for protein classical BH3-containing proteins of organism Athene cunicularia

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A663MPI8_BMF-01       MLLSCLSCFLKCPFIAGAMDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQ
A0A663MLZ1_BCL2L11      --------------------------------------------------
A0A663N909_PMAIP1-      --------------------------------------------------
                                                                          

A0A663MPI8_BMF-01       PGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQTLS
A0A663MLZ1_BCL2L11      ---------------------------------------------GSQAA
A0A663N909_PMAIP1-      --------------------------------LPGHHHKRRCGWLTAVLV
                                                                          

A0A663MPI8_BMF-01       PSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPREG
A0A663MLZ1_BCL2L11      PFSS----------------------------------------------
A0A663N909_PMAIP1-      PSAE----------------------------------------------
                        * :.                                              

A0A663MPI8_BMF-01       QREARAEVQIARKLQCIADQFHRLHIQRH---------------QQNRNQ
A0A663MLZ1_BCL2L11      -KDVQPEIWIAQELRRIGDEFNASYCPRRVTFIFLLSISLHMASKREKLN
A0A663N909_PMAIP1-      -REAVAE--CALQLRRIGDKWDL---------------------RQKILN
                         .:. .*   * :*. *.*::                       ..:  :

A0A663MPI8_BMF-01       VWWQLFLFLHNLALNAEANRNHTGQR
A0A663MLZ1_BCL2L11      HLWKLVLR------------------
A0A663N909_PMAIP1-      LLTKLFCPET----------------
                           :*.                    

© 1998-2020Legal notice