Dataset for protein classical BH3-containing proteins of organism Athene cunicularia

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A663MLZ1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Athene cunicularia GN=BCL2L11 (length=66 residues).
GSQAAPFSSKDVQPEIWIAQELRRIGDEFNASYCPRRVTFIFLLSISLHMASKREKLNHLWKLVLR
>gnl|bcl2dbpro|A0A663MPI8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Athene cunicularia GN=BMF (length=211 residues).
MLLSCLSCFLKCPFIAGAMDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTH
CCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPREGQREARAEVQI
ARKLQCIADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNAEANRNHTGQR
>gnl|bcl2dbpro|A0A663N909_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Athene cunicularia GN=PMAIP1 (length=58 residues).
LPGHHHKRRCGWLTAVLVPSAEREAVAECALQLRRIGDKWDLRQKILNLLTKLFCPET
© 1998-2020Legal notice