Dataset for protein Bim of organism Astyanax mexicanus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 * ** .*********************************************************
---------------eqGlRGqsGGGGGTLSRAEQCEQPEPGDGDPVRGPPALHNSLLGYQTRSPLFRTLSRSSSGYFSF
msrpsnratrppflkal e  cd                                                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
DSEPSSPLLMHSASTQTPSPSSQVIIHALQRISEARGDAQSFELCPGPNHCPPHRAAAAGDMQAHWYIAQELRRIGDEFN
                                                                                

       170       180       190       200   
....:....|....:....|....:....|....:....|...
*******************************************
DLYFRGAGRNGGGAQLPAQNEPAFILWMGLLIERLRQFLHRRR
                                           
© 1998-2022Legal notice