Dataset for protein Bim of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B1JXK6_BCL2L11      MSRPSNRATRPPFLKEQGERGQSGGGGGTLSRAEQCEQPEPGDGDPVRGP
A0A8B9HBP0_BCL2L11      ---------------ALGLRGCDGGGGGTLSRAEQCEQPEPGDGDPVRGP
                                         * ** .***************************

A0A3B1JXK6_BCL2L11      PALHNSLLGYQTRSPLFRTLSRSSSGYFSFDSEPSSPLLMHSASTQTPSP
A0A8B9HBP0_BCL2L11      PALHNSLLGYQTRSPLFRTLSRSSSGYFSFDSEPSSPLLMHSASTQTPSP
                        **************************************************

A0A3B1JXK6_BCL2L11      SSQVIIHALQRISEARGDAQSFELCPGPNHCPPHRAAAAGDMQAHWYIAQ
A0A8B9HBP0_BCL2L11      SSQVIIHALQRISEARGDAQSFELCPGPNHCPPHRAAAAGDMQAHWYIAQ
                        **************************************************

A0A3B1JXK6_BCL2L11      ELRRIGDEFNDLYFRGAGRNGGGAQLPAQNEPAFILWMGLLIERLRQFLH
A0A8B9HBP0_BCL2L11      ELRRIGDEFNDLYFRGAGRNGGGAQLPAQNEPAFILWMGLLIERLRQFLH
                        **************************************************

A0A3B1JXK6_BCL2L11      RRR
A0A8B9HBP0_BCL2L11      RRR
                        ***

© 1998-2022Legal notice