Dataset for protein Bim of organism Astyanax mexicanus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B1JXK6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Astyanax mexicanus GN=BCL2L11 (length=203 residues).
MSRPSNRATRPPFLKEQGERGQSGGGGGTLSRAEQCEQPEPGDGDPVRGPPALHNSLLGYQTRSPLFRTLSRSSSGYFSF
DSEPSSPLLMHSASTQTPSPSSQVIIHALQRISEARGDAQSFELCPGPNHCPPHRAAAAGDMQAHWYIAQELRRIGDEFN
DLYFRGAGRNGGGAQLPAQNEPAFILWMGLLIERLRQFLHRRR
>gnl|bcl2dbpro|A0A8B9HBP0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Astyanax mexicanus GN=BCL2L11 (length=188 residues).
ALGLRGCDGGGGGTLSRAEQCEQPEPGDGDPVRGPPALHNSLLGYQTRSPLFRTLSRSSSGYFSFDSEPSSPLLMHSAST
QTPSPSSQVIIHALQRISEARGDAQSFELCPGPNHCPPHRAAAAGDMQAHWYIAQELRRIGDEFNDLYFRGAGRNGGGAQ
LPAQNEPAFILWMGLLIERLRQFLHRRR
© 1998-2022Legal notice