Dataset for protein classical BH3-containing proteins of organism Aquila chrysaetos chrysaetos

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                                         ma appe

        90       100       110       120       130       140       150       160
                           *      .      .       :               *  :.*.   :    
vspssssqgvrlppgvtpm-r-t-ypn gyrlhvapsgfgvqvhlwiepketqtpsrpevqlsrk scma qslgwlr-y
lkaqrdgedgm  caegeg gaqfikg a      fl edle ailecleag reapacqaiahc qa   k    hash
                  e a l  ga         a aa d  a c d                      e    d  f

       170       180       190      
                    .  :            
ipkprqnrgqrvvs ptfsk  ghevnlnhtger
ch hqgf falsi  f   h     lkklff   
© 1998-2021Legal notice