Dataset for protein classical BH3-containing proteins of organism Aquila chrysaetos chrysaetos

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A663DZQ4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNAEVNRNHTGQR
>gnl|bcl2dbpro|A0A663E970_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=BCL2L11 (length=108 residues).
MAKQPPEVKAQRDGEGGRLPPAEGPGPAAQLRPGAPAALPGSRSPAPLSCDKATQTPSPPCQALSHCLSAMGDSSLGFLL
LFLHKPRGVIGARVVQLPLVLVRPKIGA
>gnl|bcl2dbpro|A0A663E983_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=BCL2L11 (length=66 residues).
ITQAAPFSPEDVQPEIWIAQELRRIGDEFNASYCPRRVTFIFSLSISLRTVSKREKLNHLWKLVLW
>gnl|bcl2dbpro|A0A663FH84_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=PMAIP1 (length=53 residues).
MPGRTLRKAAPPAAPAGREVEAQCALQLRRIGDKWDLRQKILNLLTKLFFPET
© 1998-2020Legal notice