Dataset for protein classical BH3-containing proteins of organism Aquila chrysaetos chrysaetos

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A663DZQ4_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A663E970_BCL2L11      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663FH84_PMAIP1-      --------------------------------------------------
                                                                          

A0A663DZQ4_BMF-01       LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A663E970_BCL2L11      -----------------------MAKQPPEVKAQRDGEGGRLPPAEGPGP
A0A663E983_BCL2L11      --------------------------------------------------
A0A663FH84_PMAIP1-      ------------------------------------------------MP
                                                                          

A0A663DZQ4_BMF-01       RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A663E970_BCL2L11      AAQLRPGAP-----AALPGSRSPAPLSCDKATQTPSPPCQALSHCLSAMG
A0A663E983_BCL2L11      ----ITQAA-----PFSPEDVQPEIWIAQE---------------LRRIG
A0A663FH84_PMAIP1-      GRTLRKAAP-----PAAPAGREVEAQCALQ---------------LRRIG
                               *      .      .       :               *  :.

A0A663DZQ4_BMF-01       DQ---FHRLHIQRHQQNRNQVWWQLFLFLHNLALNAEVNRNHTGQR
A0A663E970_BCL2L11      DSSLGFLLLFLHKPRGVIGARVVQLPLVLVRPKIGA----------
A0A663E983_BCL2L11      DE---FNASYCPRRVTFIFSLSISLRTVSKREKLNHLWKLVLW---
A0A663FH84_PMAIP1-      DK---WDL----------------------RQKILNLLTKLFFPET
                        *.   :                        .  :            

© 1998-2020Legal notice