Dataset for protein classical BH3-containing proteins of organism Apteryx owenii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------mdrpsyleedyss---------hsddfglagqpgemtatgiftqnqsyscllgrfqlfplthccgpgsr----
mgpargr-------------ldgldddvf-----------------------------------------------tslp
       rp  prspppapp         pplslsprrr  apm kqaadv spcereg  l aprrpghpr  ap    
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        *.         :*                                                           
-------hPsqqdkatqtpsPssssqdvmlpcgvteeprrlfygnagyrlhappvgfaldphlqeepqegq---------
wgegdpas errvrpptsla gktrv---------------------------------------------afnhylsam
       a  ppaaifhl   far splfifvrrsslls sss yfsfdadrs apmsc kat tpsppc          
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   * :*. *.*:::            .                                    
----------reahvevqiArkLrrIgDqfn----------rlhvqr-----------------------e--rnh--qr
asrwrshsla------iwc qq qc a kwhlrqkilnllaksycpetqqprnrvwwrlflslsnlavsk-tn---tw--
          ediqp ae  me      e            a f   lplnkaq ifqf ffihfc lngrel tapqkk
                                               h     k                 ak   ig  

       250       260       270
....:....|....:....|....:....|
                              
------------------------------
vncfcksilqnpawsywwlfsvcncllpvq
ql                            
e                             
© 1998-2022Legal notice