Dataset for protein classical BH3-containing proteins of organism Apteryx owenii

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8B9NX34_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Apteryx owenii GN=BMF (length=223 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHAPPVGFALDPHLQEEPQEGQREAHVEVQIARKLQCIADQFHRLHVQR
HQQNRNQVWWQLFLFLHNLALNGEANRNHTGQRQNCFCKSILQNPAWSYWWLFSVCNCLLPVQ
>gnl|bcl2dbpro|A0A8B9NX34_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Apteryx owenii GN=BMF (length=178 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGSRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHAPPVGFALDPHLQEEPQEGQREAHVEVQIARKLQCIADQFHRLHVQR
LPLPKAKETLRTAPQQKE
>gnl|bcl2dbpro|A0A8B9QMZ1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Apteryx owenii GN=BCL2L11 (length=217 residues).
MGPARGRRPRPPRSPPPAPPPPLSLSPRRRPGAPMAKQAADVNSPCEREGGRLQAPRRPGHPRPGAPTSLPWGEGDPASP
SPPVAPPTSPSPFATRSPLFIFVRRSSLLSRSSSGYFSFDADRSPAPMSCDKATQTPSPPCQAFNHYLSAMASRWRSHSL
AEDIQPEIWIAQELRRIGDEFNASYCPRRVIFRFFFSISFCAVSKREKRNHIWKRVL
>gnl|bcl2dbpro|A0A8B9S6H8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Apteryx owenii GN=PMAIP1 (length=51 residues).
APSRRARIFHLPAPGKRSVAECAMQLRRIGDKWNLRQKILNLLAKLFCPET
© 1998-2022Legal notice