Dataset for protein classical BH3-containing proteins of organism Apteryx owenii

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9S6H8_PMAIP1-      --------------------------------------------------
A0A8B9QMZ1_BCL2L11      MGPARGRRPRPPRSPPPAPP---------PPLSLSPRRRPGAPMAKQAAD
A0A8B9NX34_BMF-01       -------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFT
A0A8B9NX34_BMF-02       -------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFT
                                                                          

A0A8B9S6H8_PMAIP1-      -------------------------------------APSRRARIFHLPA
A0A8B9QMZ1_BCL2L11      VNSPCEREGGRLQAPRRPGHPRPGAPTSLPWGEGDPASPSPPVAPPTSPS
A0A8B9NX34_BMF-01       QNQSYSCLLGRFQLFPLTHCCGPGSR-----------HPEQQDKATQTLS
A0A8B9NX34_BMF-02       QNQSYSCLLGRFQLFPLTHCCGPGSR-----------HPEQQDKATQTLS
                                                              *.         :

A0A8B9S6H8_PMAIP1-      PGKRSV--------------------------------------------
A0A8B9QMZ1_BCL2L11      PFATRSPLFIFVRRSSLLSRSSSGYFSFDADRSPAPMSCDKATQTPSPPC
A0A8B9NX34_BMF-01       PSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHAPPVGFALDPHLQEEPQEG
A0A8B9NX34_BMF-02       PSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHAPPVGFALDPHLQEEPQEG
                        *                                                 

A0A8B9S6H8_PMAIP1-      --------------------------AECAMQLRRIGDKWNLRQKILNLL
A0A8B9QMZ1_BCL2L11      QAFNHYLSAMASRWRSHSLAEDIQPEIWIAQELRRIGDEFN---------
A0A8B9NX34_BMF-01       Q-------------------REAHVEVQIARKLQCIADQFH---------
A0A8B9NX34_BMF-02       Q-------------------REAHVEVQIARKLQCIADQFH---------
                                                     * :*. *.*:::         

A0A8B9S6H8_PMAIP1-      AKLFCPET------------------------------------------
A0A8B9QMZ1_BCL2L11      -ASYCPR------RVIFRFFFSISFCAVSKREKRNHIWKRVL--------
A0A8B9NX34_BMF-01       -RLHVQRHQQNRNQVWWQLFLFLHNLALNGEANRNHTGQRQNCFCKSILQ
A0A8B9NX34_BMF-02       -RLHVQRLPLPKAK----------------ETLRTAPQQKE---------
                           .                                              

A0A8B9S6H8_PMAIP1-      --------------------
A0A8B9QMZ1_BCL2L11      --------------------
A0A8B9NX34_BMF-01       NPAWSYWWLFSVCNCLLPVQ
A0A8B9NX34_BMF-02       --------------------
                                            

© 1998-2022Legal notice