Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------makqpsdvsse---cdregrql---------
mepsqcveeleddvfqsgvgspwtcpgsllsadlfaqslldcqvpriseftpvec--cgptll--------pggqlpgar
               kced eagaq          sawacp pmfqapssewshqqm--s   aeqglsps         
                       m                   ls lql------edlm-   r  hvprt         
                                            h mrgvpltspai et      f h           
                                              g   r l                           
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------qpaerp------pqlrpgaptslqtepqgnpegnhggegdsc
rgpgprrpaplpaaacdvsppaatrrtaawprglggsp--gp--pgsglt-rqasassar-aslqp--------------
                                      ta-dtsqelkkhq--sqvlkgdgvmhgceqttssshlgyags
                                      glr-sagrdtaestvvglpgsqrslq--qvhrepqrhfdtya
                                      rgslalapqh rmpgqehteppkna-rv s qdrmqpsaptr
                                        pc        gsam  kd eelwr s l l gaen  gnv
                                         a        ae    ha  ak d d g g c     el 
                                                             d     d         c  
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
phgsp---qgplappaspg----------------------------------------ssg-----tdrspapmscdks
-----rsa-----------ppegqwlraaevqlaraaypfatrsplfifvrrssvlsrs---yfsfd-g-----------
tewrrvvssrdaglapgelgtywrfvctmgtviraqlwlltrqylrlsvqqtpqnrqsvwwvlvgpfl-slrlrvevrrw
vytvgsaggyrvvtrldaaqspqparhriaqrg lm qevnmynhvrrqilqrtlspqpqrqvynlqrsqqtvnlrpwcp
lvrlslprppatsrqervsargfe q e  a a  k pdiglegegqhhhghqahingempprsevipnngnrksllvtn
grlgcihnen sqam atr eaed a           dc  d f   a eed  d gd leempasemhleefirghpdf
eqkaah dam rk e  sq                      a              e  ha il aaa fcaddgdenaa
 pe  d   f       r                                            ed     aa      e  
 md  a   d       k                                                              
 ca              d                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tqtpsppc-------------qaf---nhylsam----------------------------------------------
--------vpqalwlalrygr---rsg-------asmrlwfrfiftffdlyghqsqaepagmrpeiwiaqelrrigdefn
ggrrrtvprlnnvqklqnllskltlqwglfvlpfgdvt               eqspgtsqthtvmrssswwtqvsqsww
vasgewgskkifrlgh lailrtrkmstrtqitkvrws               hpvvvselrasqyfqlesgaksi    
lslapf q     ga  g   lrmfgarespds rili               ahrqpi  q hkqap  g         
eph na d             eclc  edh cl kgie                ehlk   l ea  a            
amg l                d  a  d   a  defd                                          
  e                                ce                                           
                                   aa                                           
                                                                                

       330       340       350        
....:....|....:....|....:....|....:...
                                      
--------------------------------------
ayyprrvflnnyqaaedhphmvilrllryivrlvwrmh
drnlg lsspss                          
      igkapd                          
      ge                              
                                      
                                      
                                      
                                      
                                      
© 1998-2022Legal notice