Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                         .                      
-----------------------------------------cqlprlssspsvvssscgrglrpstaedrp---lsppqq
mepsqcveeleddvfqsedgepgtqpgsllsadlfaqsllm-p---mqpqelthc--aepegsqlsqaqkatqt-k-asp
               kcgv sawac             mmpf-vsefelftqedtqe dqqvlrtqpgevtpgsg-hvrl
                                       cdskirpkakpiwdsrlp  llphlalmlvllgsrpnfrpd
                                         gekh grgd appacm   f ec    rhgedk eells
                                            a a a   me al             faad  adgk
                                                     c                          
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
apglpts-qvtqq-q-----------------------------------------------------------------
sqnamlplgthpeg-rlsysnhggegdvctrassssypygvmmysaspgmsatrtpsrnvsssvppvfwvatrytvqsrr
rlhvrgdcasee-prptfsghiadqystspssrrleqlserlltppglapilppsdlggrlrgivenlifvrassrll s
pveql--w----tsnv qlas   amaselhg h an qapaaskede ffeea  ied klea   c a q pgpeg  
l  dism rrssral   e c        a        a    pe  a  e d   f                       
e     k mergd                                                                   
      e fcna                                                                    
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------arspaplsagkptq-p-----a-nqwl-am--------------s--------gg-r--------------
ssgyfvkdw--------cd-s--t-ssvcq-lghy-s--gvqsrrmrqiltfq-wrrrqqeq--s-psvwyvvynlrmgn
rtdn sfstdglwrsmp--wawvraqppvppf-a-tlvirnlllwklfdindfymyqhvlssqqnqlrqkwqsllrilhl
m ae qegivpyrsrvvtyt-vsprtgsrlees-lsrraediia fadcfaaaflwlsnhqrptmhnqp rfqe  fi d
      d frepklakgsvswqlmkpaqqg glshrqmr a            dh g hegpa laell ial       
         k a g f  sr lhl l ela  fe qhg                e d  a h  h  hi           
                   p a c a  a   e  aae                          e  eh           
                   g   a        a                                   e           
                   f                                                            

       250     
....:....|....:
               
---------------
lpnpyyprrpsmrpr
eflnrghnanglpsn
 afagee  iegg e
           ae d
               
               
               
               
© 1998-2020Legal notice