Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------makqpsdvsse---cdregrql---------------
mepsqcveeleddvfqsgvgspwtcpgsllsadlfaqmfqiceverssqedl-pcqmaepglspspggqlpgarrgpgpr
               kced eagaq    sawacpc slldpplsplel---vstlv-g---a-t               
                       m             vprmsqfp-aq-stwthpalr-trv-r-               
                                        a s--w--gfpcm-     qqppla               
                                           st vrcqm g       h hc                
                                            r g   i         f  a                
                                            h                                   
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                              .                                 
--------------------------------qpaerppqlrpgaptslqtepqgnpegnhggegdscphgs---pqgpl
rpaplpaaacdvsppaatrrtaawprglggsstegkltqg--sashprqapllp------------------rls-----
                               a-aldae-tvsqvkssqgvmggcedashqqrqptstshyrgtyaagrra
                               pp-d--rspsagppgapapld--vvtrepsqlfyanrtvwvpvvgstsv
                               lmr-tkar-gvelte erna-rvqshqtrmhrgdplanrlrkspvepdt
                                g qp  msaq hhd  elwr e lcldglepsagkvlqkqgrltpm s
                                a ph  gk     a   ksq d g g ca n  cglgpdlei rli r
                                   g  ae         d     e a          em acg ncf k
                                                                     f  ad d e g
                                                                         a   a  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
appaspg------------------------------------lsrsssg-----tdrspapmscdkstqtpsppc----
-------ppegqwlraaevqlaraaypfatrsplfifvrrssv-------yfsfd---------------------vpqa
ssapgtlgtywrfvctmgtviraqlwlltrqylrlsvqqtptqrdsvwwvlvgpflgslrlrvevrrwggrgetvprkin
vlssdaaqspqparhriaqrg lm qevnmynhvrrqilqrqnsqqpqrqvynlqrnqqtvnsrpwtpvasarw s    
rhrlyvsargfe q e  a a  k pdiglegegqhhhghqrmipkgmpprsevimhngnrkrllvdnlsh pa q    
qfnersr eaed a           dc  d f   a eedkllengeleempasea leefilghpcfepg n       
lac nrq                      a          gah geaha il aa  fcad gdena ame l       
h   ae                                  a e ed    ed     a                      
g    d                                    d  a                                  
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------qaf---nhylsam----------------------------------------------------------
lwlalrygr---rsg-------asmrlwfrfiftffdlyghqsqaepagmrpeiwiaqelrrigdefnayyprrvflnny
vlghqlallrttlqwglfvlpfgdvt               eqspgtsqthtvmrssswwtqvsqswwdrnlg lsspss
 ga  g   lrrkmsrrtqitkvrws               hpvvvselrasqyfqlesgaksi          igkapd
         klmfgaeespds rili               ahrqpi  q hkqap  g               ge    
         ecla  ddh cl kgie                ehlk   l ea  a                        
         d         a  defd                                                      
                       ce                                                       
                       aa                                                       
                                                                                

       330       340      
....:....|....:....|....:.
                          
--------------------------
qaaedhphmvilrllryivrlvwrmh
                          
                          
                          
                          
                          
                          
                          
                          
© 1998-2022Legal notice