Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------makqpsdvssecdregrql-----------------------------------------------
sawacpcqmfqipe------------e----pspggqlpgarrgpgprrpaplpaaacdvsppaatrrtaawprglggsp
        vprassfepseqqdvesa-dgls--                                               
              stmvgcecmcplqvhvfrt                                               
              kcwe  awcg rpldrpsc                                               
                g    ma     p gk                                                
                              a                                                 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qpaerp------pqlrpgaptslqtepqg-p-g-----g---p-------------------------------------
tagd--pgsgkh-rqaa-l-ld-ashq--n-e-nhgge-dsc-hgspsssqgplappaspggrpqravraaetrgaalss
ms--varqvcqtagaq-a-lg-a---apsqttssshhg pgsvrtrgrvnsydagtqldks                aap
gdtwk ckmaeps-tcspsr-tvelf-aqrrgtrllsq tylteegshhgpnaskrmeaea                   
e-pv   a    rp--e pearrdwsv llhfapakpl eqahqd aa  ed r le  d                    
sves         ws   gd g rgrt  h a    a  ae  ca     a     a  a                    
   p          g      e ncpr  g                                                  
   k                     a                                                      
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------pl-------------ssgyfs-fdtdrspapmscdkstqtpsppc-------------qaf---nhylsamasm
pfatrs--fifvrrssvlsrs------l---g--trtl-pr-ps----l-pvpinlwghqrygrgvlesaqrlfctf---
dsllecqvsrlqlfplthccgpgprpt sql-qc----ev-s-ggrvm-a-   a gaalg   dttaepgdf-ys-ggv
 ltmdtl qsqsvttwlsqvvqplqvg pleekarqsvd-adw-sgrlt q             -l-rtyd--v-psrel
 i   g  pehhss a peqpmevmse afr avnvrswrvtnvphlva               r-rpqw-qwqv-nvdy
        c afgh   m gmhaslda eea shllkpv srfrdaap                kranmswptpnllsaw
                     g ee    a  pgee  l peaaa  e                ek lirrlsdigikrr
                     c  d        e d    mc     a                 c kggekm d adqp
                                         a                         cf  e  a   ki
                                                                              if
                                                                              ce
                                                                               a

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
r------------------------r------------------------------------------------------
-lwalagfptyappgvqsqaepagm-peiwiaqelrrigdefnayyprrvflnnyqaaedvphmvilrllryivrlvwrm
tssvvysvtrvslylhepspgtewghevmaqsswwaqvsqswyrrwrqqsssswvsvwwrhllnllnla pmpsgrrhpl
scrqtwlpgmsnql frwrevqwqtdvqyrslrvmtnsqnqqwelrvsllqqqssrspqq  yf hmg  ngfrnhnglg
kaplrfilalrlag ehqvvrsslratlvqpvesgqkfledivd nlgeigpprrprk a   a  a   afee glaae
i lgp eg fqd   afiprpiqiq sksga  rf ddi a h  h   hekapn                         
f afa    af     ahlqked l hiqf   k  c a          g g hd                         
e                ehl    h aag    g               e                              
d                 gd    a                                                       
a                                                                               
                                                                                
                                                                                

    
....
    
----
hrpn
pk e
me  
l   
    
    
    
    
    
    
    
© 1998-2022Legal notice