Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A2K5BYA0_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Aotus nancymaae GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A2K5CA89_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=105 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGDISLWFRF
IFTFFDLYGHHHSQGTEQLHHKYFS
>gnl|bcl2dbpro|A0A2K5CA89_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=174 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRISLPSD
>gnl|bcl2dbpro|A0A2K5CFK7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Aotus nancymaae GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPSRAPADLEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A2K5CLG5_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Aotus nancymaae GN=BIK (length=155 residues).
MSEVRPLSSDILMETLLCEQFVHPLTMEVVGGSDPEEDLDPVEDPLECMENSDALVLQLACIADQMDVSLRARRLAQLYE
VAMYSPGLAFILDRTDIGDVLSGIVEVFANFQEDIVRLWRSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
>gnl|bcl2dbpro|A0A2K5E1Q4_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Aotus nancymaae GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYASAEPKSRVVAGPPLSAQPGFEWRREQEWGRPE
>gnl|bcl2dbpro|A0A2K5E1Q4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Aotus nancymaae GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K5E6A6_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Aotus nancymaae GN=BAD (length=152 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPGLPGDASHQQGQPTSSSHHGGEYSTCASASSSENPSAR
MLSKASAGMSAPATDSENVKLEVPCWVATAPTPQGRRRTKGWRRSPAPFGAVRAQHPPTSGQHSAMAASSGG
>gnl|bcl2dbpro|A0A2K5E6A6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Aotus nancymaae GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPGLPGDASHQQGQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTQVIQSWWDRNLGR
GGSAPSQ
>gnl|bcl2dbpro|A0A2K5F6X4_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Aotus nancymaae GN=BBC3 (length=130 residues).
KCGVGSAWACPCQVPRASSSTWVPCQMCGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRR
MADDLNAQYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
© 1998-2020Legal notice