Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CFK7_PMAIP1-      ---------------------------------------MPGKKARKSAQ
A0A2K5BYA0_HRK-01       --------------------------------------MCPCPLHRGRGP
A0A2K5F6X4_BBC3-02      ---------------KCGVGSAWACP---------------CQVPRASSS
A0A2K5E1Q4_BMF-02       MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
A0A2K5E1Q4_BMF-01       MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
A0A2K5CA89_BCL2L11      ----------------------------------------------MAKQ
A0A2K5CLG5_BIK-01       ----------------------------------------MSEVRPLSSD
A0A2K5CA89_BCL2L11      ----------------------------------------------MAKQ
A0A2K5E6A6_BAD-03       ----------------------------------------MFQIPEFEPS
A0A2K5E6A6_BAD-01       ----------------------------------------MFQIPEFEPS
                                                                          

A0A2K5CFK7_PMAIP1-      PSPSRAPADLEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT-------
A0A2K5BYA0_HRK-01       PAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRR----
A0A2K5F6X4_BBC3-02      TWVPCQMCGPQPSLSLAEQHLE---SPVPSAPGAL---------------
A0A2K5E1Q4_BMF-02       PLTHC--CGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5E1Q4_BMF-01       PLTHC--CGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5CA89_BCL2L11      PSDVSSECDREGRQLQPAERP------PQLRPGAPTSLQTEPQ-------
A0A2K5CLG5_BIK-01       ILMETLLCEQFVHPLTMEVVGGSDPEEDLDPVEDPLECMENSDALVLQLA
A0A2K5CA89_BCL2L11      PSDVSSECDREGRQLQPAERP------PQLRPGAPTSLQTEPQGNP--EG
A0A2K5E6A6_BAD-03       EQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPGLPGD-ASHQQGQPTSSS
A0A2K5E6A6_BAD-01       EQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPGLPGD-ASHQQGQPTSSS
                               .                                          

A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02       S-------------------------------------------------
A0A2K5E1Q4_BMF-01       N-------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5CLG5_BIK-01       CIADQMDVSLRARRLAQLYEVAMYSPGLAFILDRTDIGDVLSGIVEVF--
A0A2K5CA89_BCL2L11      NHGGEGDSCPHGS----PQGPLAPPASPGPFATRSPL----------FIF
A0A2K5E6A6_BAD-03       HHGGEYSTCASASSSENPSARMLSKASAGMSAPATDSENVKLEVP--CWV
A0A2K5E6A6_BAD-01       HHGGAGAVETRSRHSSYPAG---TEEDEGMEEEPSPFRGRSRSAPPNLWA
                                                                          

A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5BYA0_HRK-01       -------------------APAPGALPTYWPWLCAAAQVAALAAWLLGRR
A0A2K5F6X4_BBC3-02      ---------------------------AGGPTQAAPGVRGEEEQWAREIG
A0A2K5E1Q4_BMF-02       -------------------AEPKSRVVAGPPL-----SAQPGFEWR----
A0A2K5E1Q4_BMF-01       -------------------AGYRLPLPASFPAVLPLGEQPPEGQWQHRAE
A0A2K5CA89_BCL2L11      -------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMG
A0A2K5CLG5_BIK-01       ------------ANFQEDIVRLWRSLSSGSWVSRKQAVLLALLALLLAM-
A0A2K5CA89_BCL2L11      VRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-
A0A2K5E6A6_BAD-03       ATAPTPQGRRRT----KGWRRSPAPFGAVRAQHPPTS-----GQHSAMA-
A0A2K5E6A6_BAD-01       AQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQS-----SSWTQVI-
                                                                          

A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5BYA0_HRK-01       NL------------------------------------------------
A0A2K5F6X4_BBC3-02      AQLRRMADDLNAQYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAP
A0A2K5E1Q4_BMF-02       -------------------------REQEW--------------------
A0A2K5E1Q4_BMF-01       VQIARKLQCIADQFHRLHVQQHQQNRNRVWWQVL-LFLHNLALNGEENRN
A0A2K5CA89_BCL2L11      DISLWFRFIFTFFDLYGHHHSQGTEQLHHKYFS-----------------
A0A2K5CLG5_BIK-01       ------------FS--------GGLHLLLK--------------------
A0A2K5CA89_BCL2L11      ------------ASMRQSQAEPAGMRPEIWIAQELRRIGDEFNAYYPRRI
A0A2K5E6A6_BAD-03       ------------AS-------SGG--------------------------
A0A2K5E6A6_BAD-01       ------------QSWWDRNLGRGGSAPSQ---------------------
                                                                          

A0A2K5CFK7_PMAIP1-      -----
A0A2K5BYA0_HRK-01       -----
A0A2K5F6X4_BBC3-02      EMEPN
A0A2K5E1Q4_BMF-02       -GRPE
A0A2K5E1Q4_BMF-01       GAGPR
A0A2K5CA89_BCL2L11      -----
A0A2K5CLG5_BIK-01       -----
A0A2K5CA89_BCL2L11      SLPSD
A0A2K5E6A6_BAD-03       -----
A0A2K5E6A6_BAD-01       -----
                             

© 1998-2020Legal notice