Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5CLG5_BIK-01       ----------------------------------------------MSEV
A0A2K5E6A6_BAD-01       -------------------------------------------MFQIPEF
A0A2K5E6A6_BAD-02       -------------------------------------------MFQIPEF
A0A2K5E6A6_BAD-03       -------------------------------------------MFQIPEF
A0A2K5F6X4_BBC3-03      -----------------------------------SAWACPCQVPRASSS
A0A2K5CA52_BCL2L11      -------------------------------------------------M
A0A2K5CA52_BCL2L11      -------------------------------------------------M
A0A2K5CA52_BCL2L11      -------------------------------------------------M
A0A2K5CA52_BCL2L11      -------------------------------------------------M
A0A2K5CA52_BCL2L11      -------------------------------------------------M
A0A2K5CA52_BCL2L11      -------------------------------------------------M
A0A2K5CA52_BCL2L11      -------------------------------------------------M
A0A2K5CA52_BCL2L11      -------------------------------------------------M
A0A2K5CA52_BCL2L11      -------------------------------------------------M
A0A2K5CA52_BCL2L11      -------------------------------------------------M
A0A2K5BYA0_HRK-01       -----------------------MCP---------------CPLHRGRG-
A0A2K5F6X4_BBC3-01      ---------------KCGVGSAWACP---------------CQVPRASSS
A0A2K5F6X4_BBC3-02      ---------------KCGVGSAWACP---------------CQVPRASSS
A0A2K5E1Q4_BMF-02       MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
A0A2K5E1Q4_BMF-01       MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
                                                                          

A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5CLG5_BIK-01       RPLSSDILMETLLCEQFVHPL-----------------------------
A0A2K5E6A6_BAD-01       EPSEQEDSSS---AERGLSPS-----------------------------
A0A2K5E6A6_BAD-02       EPSEQEDSSS---AERGLSPS-----------------------------
A0A2K5E6A6_BAD-03       EPSEQEDSSS---AERGLSPS-----------------------------
A0A2K5F6X4_BBC3-03      TWVPCQMCGP---RERHGPRTPGGQLPGARRGPGPRRPAPLPAAACDVSP
A0A2K5CA52_BCL2L11      AKQPSDVSSE---CDREGRQL-----------------------------
A0A2K5CA52_BCL2L11      AKQPSDVSSE---CDREGRQL-----------------------------
A0A2K5CA52_BCL2L11      AKQPSDVSSE---CDREGRQL-----------------------------
A0A2K5CA52_BCL2L11      AKQPSDVSSE---CDREGRQL-----------------------------
A0A2K5CA52_BCL2L11      AKQPSDVSSE---CDREGRQL-----------------------------
A0A2K5CA52_BCL2L11      AKQPSDVSSE---CDREGRQL-----------------------------
A0A2K5CA52_BCL2L11      AKQPSDVSSE---CDREGRQL-----------------------------
A0A2K5CA52_BCL2L11      AKQPSDVSSE---CDREGRQL-----------------------------
A0A2K5CA52_BCL2L11      AKQPSDVSSE---CDREGRQL-----------------------------
A0A2K5CA52_BCL2L11      AKQPSDVSSE---CDREGRQL-----------------------------
A0A2K5BYA0_HRK-01       ---PPAVC------------------------------------------
A0A2K5F6X4_BBC3-01      TWVPCQMCET----------------------------------------
A0A2K5F6X4_BBC3-02      TWVPCQMCGP----------------------------------------
A0A2K5E1Q4_BMF-02       PLTHC--CGP----------------------------------------
A0A2K5E1Q4_BMF-01       PLTHC--CGP----------------------------------------
                                                                          

A0A2K5CFK7_PMAIP1-      ---------------------------------MPGKKARKSAQPS----
A0A2K5CLG5_BIK-01       -----------------------------TMEVVGGSDPEEDLDPVEDPL
A0A2K5E6A6_BAD-01       ------------------TAGDRPPGSGKHPRQAPGLPGD-ASHQQGQPT
A0A2K5E6A6_BAD-02       ------------------TAGDRPPGSGKHPRQAPGLPGD-ASHQQGQPT
A0A2K5E6A6_BAD-03       ------------------TAGDRPPGSGKHPRQAPGLPGD-ASHQQGQPT
A0A2K5F6X4_BBC3-03      PAATRRTAAWPRGLGGSPQPPPRP------APGREGPEARRNWRRPGGPG
A0A2K5CA52_BCL2L11      ------------------QPAERP------PQLRPGAPTSLQTEPQ----
A0A2K5CA52_BCL2L11      ------------------QPAERP------PQLRPGAPTSLQTEPQ----
A0A2K5CA52_BCL2L11      ------------------QPAERP------PQLRPGAPTSLQTEPQ----
A0A2K5CA52_BCL2L11      ------------------QPAERP------PQLRPGAPTSLQTEPQGNPE
A0A2K5CA52_BCL2L11      ------------------QPAERP------PQLRPGAPTSLQTEPQGNPE
A0A2K5CA52_BCL2L11      ------------------QPAERP------PQLRPGAPTSLQTEPQGNPE
A0A2K5CA52_BCL2L11      ------------------QPAERP------PQLRPGAPTSLQTEPQGNPE
A0A2K5CA52_BCL2L11      ------------------QPAERP------PQLRPGAPTSLQTEPQGNPE
A0A2K5CA52_BCL2L11      ------------------QPAERP------PQLRPGAPTSLQTEPQGNPE
A0A2K5CA52_BCL2L11      ------------------QPAERP------PQLRPGAPTSLQTEPQGNPE
A0A2K5BYA0_HRK-01       --------------------ACSAGRLGLRSSAAQLTAARLKALGDELHQ
A0A2K5F6X4_BBC3-01      ------------------RGAAAAPPLTLEGPVQSHHGTPALSQGPQSPR
A0A2K5F6X4_BBC3-02      ------------------QPSLSLAEQHLE---SPVPSAPGAL-------
A0A2K5E1Q4_BMF-02       ------------------GLRPTSQEDKATQTLSPASPSQGVMLPCGVTE
A0A2K5E1Q4_BMF-01       ------------------GLRPTSQEDKATQTLSPASPSQGVMLPCGVTE
                                                                          

A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5CLG5_BIK-01       ECMENSDALVLQLACIADQMDVSLRARRL---------------AQLYEV
A0A2K5E6A6_BAD-01       SSSHHGGAGAVETRSRHSSYPAGTEEDEG---------------------
A0A2K5E6A6_BAD-02       SSSHHGGTSSPEERGHSNADAAKLQLDAS---------------------
A0A2K5E6A6_BAD-03       SSSHHGGEYSTCASASSSENPSARMLSKA---------------------
A0A2K5F6X4_BBC3-03      GRSHPGGPGSPRGGGAVGPGDRGPAAADGGRPQRAVRAAETRGAAAAPPL
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      GNHGGEGDSCPHGSP---QGPLAPPASPG-------------------PF
A0A2K5CA52_BCL2L11      GNHGGEGDSCPHGSP---QGPLAPPASPG-------------------PF
A0A2K5CA52_BCL2L11      GNHGGEGDSCPHGSP---QGPLAPPASPG-------------------PF
A0A2K5CA52_BCL2L11      GNHGGEGDSCPHGSP---QGPLAPPASPG-------------------PF
A0A2K5CA52_BCL2L11      GNHGGEGDSCPHGSP---QGPLAPPASPG-------------------PF
A0A2K5CA52_BCL2L11      GNHGGEGDSCPHGSP---QGPLAPPASPG-------------------PF
A0A2K5CA52_BCL2L11      GNHGGEGDSCPHGSP---QGPLAPPASPG-------------------PF
A0A2K5BYA0_HRK-01       ---------RTMWRRRARSRRA-PAPGALPTYWPWLCAAAQVAALAAWLL
A0A2K5F6X4_BBC3-01      DGAQLGACTRPVDVRDSGGRPL-PPPDTLASAGDFLCTM-----------
A0A2K5F6X4_BBC3-02      -----------------AGGPTQAAPGVRGEEEQWAREIGAQLRRMADDL
A0A2K5E1Q4_BMF-02       EPQRLFYASAEPKSRVVAGPPL-----SAQPGFEWR--------------
A0A2K5E1Q4_BMF-01       EPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCI
                                                                          

A0A2K5CFK7_PMAIP1-      ---------------------------PSRAPADLEVECATQLRRFGDKL
A0A2K5CLG5_BIK-01       AMYSPGLAFILDRTDIGDVLSGIVEVFANFQEDIVRLWRSLSSGSWVSRK
A0A2K5E6A6_BAD-01       -------------------MEEEPSPFRGRSR------------SAPP--
A0A2K5E6A6_BAD-02       -------------------HPVLVGSELGQGRLRSLPVTFAPHPETPPVP
A0A2K5E6A6_BAD-03       -------------------SAGMSAPATDSENVKLEVPCWVATAPTPQ--
A0A2K5F6X4_BBC3-03      TLEGPVQSHHGTPALSQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPP--
A0A2K5CA52_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPC--
A0A2K5CA52_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPC--
A0A2K5CA52_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPC--
A0A2K5CA52_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC--
A0A2K5CA52_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC--
A0A2K5CA52_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC--
A0A2K5CA52_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC--
A0A2K5CA52_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC--
A0A2K5CA52_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC--
A0A2K5CA52_BCL2L11      ATRSPLFIFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC--
A0A2K5BYA0_HRK-01       GRRNL---------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A2K5F6X4_BBC3-02      NAQYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN-----
A0A2K5E1Q4_BMF-02       ---------------REQEW---------------------GRPE-----
A0A2K5E1Q4_BMF-01       ADQFHRLHVQQHQQNRNRVWWQVL-LFLHNLALNGEENRNGAGPR-----
                                                                          

A0A2K5CFK7_PMAIP1-      NFRQKLLNLISKLFCSGT--------------------------------
A0A2K5CLG5_BIK-01       QAVLLALLALLLAMFSGGLHLLLK--------------------------
A0A2K5E6A6_BAD-01       -NLWAAQRYGRELRRMSDEFVDSFKGL-----------------PRPKSA
A0A2K5E6A6_BAD-02       IALGGHLGYGRKCFLQGELTQIPFRCV-----------------------
A0A2K5E6A6_BAD-03       ---------GRRRTKGWRRSPAPFGAVR---------------AQHPPTS
A0A2K5F6X4_BBC3-03      -----------DTLASAGDFLCTM--------------------------
A0A2K5CA52_BCL2L11      -----------QAF---NHYLSAMDEAT---------------ESSLGIA
A0A2K5CA52_BCL2L11      -----------QAF---NHYLSAMGDISLWFRFIFTFFDLYGHHHSQGTE
A0A2K5CA52_BCL2L11      -----------QAF---NHYLSAMASMR---------------QSQAEPA
A0A2K5CA52_BCL2L11      -----------QAF---NHYLSAMVREI---------------EEVVV--
A0A2K5CA52_BCL2L11      -----------QAF---NHYLSAMADWD----------------------
A0A2K5CA52_BCL2L11      -----------QAF---NHYLSAMGIFE----------------------
A0A2K5CA52_BCL2L11      -----------QAF---NHYLSAMASMR---------------QSQAEPA
A0A2K5CA52_BCL2L11      -----------QAF---NHYLSAMASMR---------------QSQAEPA
A0A2K5CA52_BCL2L11      -----------QAF---NHYLSAMASMR---------------QSQAEPA
A0A2K5CA52_BCL2L11      -----------QAF---NHYLSAMASMR---------------QSQAEPA
A0A2K5BYA0_HRK-01       --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
                                                                          

A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K5E6A6_BAD-01       GTATQMRQSSSWTQVIQSWWDRNLGRGGSAPSQ-----------------
A0A2K5E6A6_BAD-02       --------------------------------------------------
A0A2K5E6A6_BAD-03       GQHSAMAASSGG--------------------------------------
A0A2K5F6X4_BBC3-03      --------------------------------------------------
A0A2K5CA52_BCL2L11      LRREVQWPLEWLAKSS----------------------------------
A0A2K5CA52_BCL2L11      QLHHKYFS------------------------------------------
A0A2K5CA52_BCL2L11      GMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYI
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      GMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYI
A0A2K5CA52_BCL2L11      GMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYI
A0A2K5CA52_BCL2L11      GMRPEIWIAQELRRIGDEFNAYYPRRLEK---------------------
A0A2K5CA52_BCL2L11      GMRPEIWIAQELRRIGDEFNAYYPRRISLPSD------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
                                                                          

A0A2K5CFK7_PMAIP1-      --------
A0A2K5CLG5_BIK-01       --------
A0A2K5E6A6_BAD-01       --------
A0A2K5E6A6_BAD-02       --------
A0A2K5E6A6_BAD-03       --------
A0A2K5F6X4_BBC3-03      --------
A0A2K5CA52_BCL2L11      --------
A0A2K5CA52_BCL2L11      --------
A0A2K5CA52_BCL2L11      VRLVWRMH
A0A2K5CA52_BCL2L11      --------
A0A2K5CA52_BCL2L11      --------
A0A2K5CA52_BCL2L11      --------
A0A2K5CA52_BCL2L11      VRLVWRMH
A0A2K5CA52_BCL2L11      VRLVWRMH
A0A2K5CA52_BCL2L11      --------
A0A2K5CA52_BCL2L11      --------
A0A2K5BYA0_HRK-01       --------
A0A2K5F6X4_BBC3-01      --------
A0A2K5F6X4_BBC3-02      --------
A0A2K5E1Q4_BMF-02       --------
A0A2K5E1Q4_BMF-01       --------
                                

© 1998-2022Legal notice