Dataset for protein classical BH3-containing proteins of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5CLG5_BIK-01       ----------------------------------------MSEVRPLSSD
A0A2K5E6A6_BAD-01       -------------------------------------MFQIPEFEPSEQE
A0A2K5E6A6_BAD-03       -------------------------------------MFQIPEFEPSEQE
A0A2K5E6A6_BAD-02       -------------------------------------MFQIPEFEPSEQE
A0A2K5F6X4_BBC3-03      -----------------------------SAWACPCQVPRASSSTWVPCQ
A0A2K5CA52_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CA52_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CA52_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CA52_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CA52_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CA52_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CA52_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CA52_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CA52_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CA52_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5BYA0_HRK-01       -----------------------MCP---------------CPLHRGRG-
A0A2K5F6X4_BBC3-01      ---------------KCGVGSAWACP---------------CQVPRASSS
A0A2K5F6X4_BBC3-02      ---------------KCGVGSAWACP---------------CQVPRASSS
A0A2K5E1Q4_BMF-02       MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
A0A2K5E1Q4_BMF-01       MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
                                                                          

A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5CLG5_BIK-01       ILMETLLCEQFVHPL-----------------------------------
A0A2K5E6A6_BAD-01       DSSS---AERGLSPS-----------------------------------
A0A2K5E6A6_BAD-03       DSSS---AERGLSPS-----------------------------------
A0A2K5E6A6_BAD-02       DSSS---AERGLSPS-----------------------------------
A0A2K5F6X4_BBC3-03      MCGP---RERHGPRTPGGQLPGARRGPGPRRPAPLPAAACDVSPPAATRR
A0A2K5CA52_BCL2L11      VSSE---CDREGRQL-----------------------------------
A0A2K5CA52_BCL2L11      VSSE---CDREGRQL-----------------------------------
A0A2K5CA52_BCL2L11      VSSE---CDREGRQL-----------------------------------
A0A2K5CA52_BCL2L11      VSSE---CDREGRQL-----------------------------------
A0A2K5CA52_BCL2L11      VSSE---CDREGRQL-----------------------------------
A0A2K5CA52_BCL2L11      VSSE---CDREGRQL-----------------------------------
A0A2K5CA52_BCL2L11      VSSE---CDREGRQL-----------------------------------
A0A2K5CA52_BCL2L11      VSSE---CDREGRQL-----------------------------------
A0A2K5CA52_BCL2L11      VSSE---CDREGRQL-----------------------------------
A0A2K5CA52_BCL2L11      VSSE---CDREGRQL-----------------------------------
A0A2K5BYA0_HRK-01       ---PPAVC----ACS-----------------------------------
A0A2K5F6X4_BBC3-01      TWVPCQMCETRGAAA-----------------------------------
A0A2K5F6X4_BBC3-02      TWVPCQMCGPQPSLS-----------------------------------
A0A2K5E1Q4_BMF-02       PLTHC--CGPGLRPT-----------------------------------
A0A2K5E1Q4_BMF-01       PLTHC--CGPGLRPT-----------------------------------
                                                                          

A0A2K5CFK7_PMAIP1-      ------------MPGKKARKSAQPSPSRAPADLEVECATQLRRFGDKLNF
A0A2K5CLG5_BIK-01       -----------------TMEVVGGSDPEEDLDPVEDPLECMENSDALVLQ
A0A2K5E6A6_BAD-01       ------------TAGDRPPG--SGKHPRQAPGLPGDASHQQGQPTSSSHH
A0A2K5E6A6_BAD-03       ------------TAGDRPPG--SGKHPRQAPGLPGDASHQQGQPTSSSHH
A0A2K5E6A6_BAD-02       ------------TAGDRPPG--SGKHPRQAPGLPGDASHQQGQPTSSSHH
A0A2K5F6X4_BBC3-03      TAAWPRGLGGSPQPPPRPAPGREGPEARRNWRRPGGPGGRSHPGGPGSPR
A0A2K5CA52_BCL2L11      ------------QPAERPPQLRPGAPTSLQTEPQ----------------
A0A2K5CA52_BCL2L11      ------------QPAERPPQLRPGAPTSLQTEPQ----------------
A0A2K5CA52_BCL2L11      ------------QPAERPPQLRPGAPTSLQTEPQ----------------
A0A2K5CA52_BCL2L11      ------------QPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPH
A0A2K5CA52_BCL2L11      ------------QPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPH
A0A2K5CA52_BCL2L11      ------------QPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPH
A0A2K5CA52_BCL2L11      ------------QPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPH
A0A2K5CA52_BCL2L11      ------------QPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPH
A0A2K5CA52_BCL2L11      ------------QPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPH
A0A2K5CA52_BCL2L11      ------------QPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPH
A0A2K5BYA0_HRK-01       -----------AGRLGLRSSAAQLTAARLKALGDELHQ---------RTM
A0A2K5F6X4_BBC3-01      -----------APPLTLEGPVQSHHGTPALSQGPQSPRDGAQLGACTRPV
A0A2K5F6X4_BBC3-02      -----------LAEQHLE---SPVPSAPGAL-------------------
A0A2K5E1Q4_BMF-02       -----------SQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYASAEP
A0A2K5E1Q4_BMF-01       -----------SQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGY
                                                  .                       

A0A2K5CFK7_PMAIP1-      RQKLLNLISKLFCSGT----------------------------------
A0A2K5CLG5_BIK-01       LACIADQMDVSLRARRL---------------AQLYEVAMYSPGLAFILD
A0A2K5E6A6_BAD-01       GGAGAVETRSRHSSYPA---------------------------------
A0A2K5E6A6_BAD-03       GGEYSTCASASSSENPS---------------------------------
A0A2K5E6A6_BAD-02       GGTSSPEERGHSNADAA---------------------------------
A0A2K5F6X4_BBC3-03      GGGAVGPGDRGPAAADGGRPQRAVRAAETRGAAAAPPLTLEGPVQSHHGT
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      GS---PQGPLAPPASPG-------------------PFATRSPLFIFVRR
A0A2K5CA52_BCL2L11      GS---PQGPLAPPASPG-------------------PFATRSPLFIFVRR
A0A2K5CA52_BCL2L11      GS---PQGPLAPPASPG-------------------PFATRSPLFIFVRR
A0A2K5CA52_BCL2L11      GS---PQGPLAPPASPG-------------------PFATRSPLFIFVRR
A0A2K5CA52_BCL2L11      GS---PQGPLAPPASPG-------------------PFATRSPLFIFVRR
A0A2K5CA52_BCL2L11      GS---PQGPLAPPASPG-------------------PFATRSPLFIFVRR
A0A2K5CA52_BCL2L11      GS---PQGPLAPPASPG-------------------PFATRSPLFIFVRR
A0A2K5BYA0_HRK-01       WRRRARSRRA-PAPGALPTYWPWLCAAAQVAALAAWLLGRRNL-------
A0A2K5F6X4_BBC3-01      DVRDSGGRPL-PPPDTLASAGDFLCTM-----------------------
A0A2K5F6X4_BBC3-02      -----AGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
A0A2K5E1Q4_BMF-02       KSRVVAGPPL-----SAQPGFEWR--------------------------
A0A2K5E1Q4_BMF-01       RLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQH
                                                                          

A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5CLG5_BIK-01       RTDIGDVLSGIVEVFANFQEDIVRLWRSLSSGSWVSRKQAVLLALLALLL
A0A2K5E6A6_BAD-01       GTEEDEGMEEEPSPFRGRSR------------SAPP---NLWAAQRYGRE
A0A2K5E6A6_BAD-03       ARMLSKASAGMSAPATDSENVKLEVPCWVATAPTPQ-----------GRR
A0A2K5E6A6_BAD-02       KLQLDASHPVLVGSELGQGRLRSLPVTFAPHPETPPVPIALGGHLGYGRK
A0A2K5F6X4_BBC3-03      PALSQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPP-------------D
A0A2K5CA52_BCL2L11      ----------------DRSPAPMSCDKSTQTPSPPC-------------Q
A0A2K5CA52_BCL2L11      ----------------DRSPAPMSCDKSTQTPSPPC-------------Q
A0A2K5CA52_BCL2L11      ----------------DRSPAPMSCDKSTQTPSPPC-------------Q
A0A2K5CA52_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC-------------Q
A0A2K5CA52_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC-------------Q
A0A2K5CA52_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC-------------Q
A0A2K5CA52_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC-------------Q
A0A2K5CA52_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC-------------Q
A0A2K5CA52_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC-------------Q
A0A2K5CA52_BCL2L11      SSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC-------------Q
A0A2K5BYA0_HRK-01       --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A2K5F6X4_BBC3-02      PQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN-----------------
A0A2K5E1Q4_BMF-02       ---REQEW---------------------GRPE-----------------
A0A2K5E1Q4_BMF-01       QQNRNRVWWQVL-LFLHNLALNGEENRNGAGPR-----------------
                                                                          

A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5CLG5_BIK-01       AMFSGGLHLLLK--------------------------------------
A0A2K5E6A6_BAD-01       LRRMSDEFVDSFKGL-----------------PRPKSAGTATQMRQSSSW
A0A2K5E6A6_BAD-03       RTKGWRRSPAPFGAVR---------------AQHPPTSGQHSAMAASSGG
A0A2K5E6A6_BAD-02       CFLQGELTQIPFRCV-----------------------------------
A0A2K5F6X4_BBC3-03      TLASAGDFLCTM--------------------------------------
A0A2K5CA52_BCL2L11      AF---NHYLSAMGDISLWFRFIFTFFDLYGHHHSQGTEQLHHKYFS----
A0A2K5CA52_BCL2L11      AF---NHYLSAMDEAT---------------ESSLGIALRREVQWPLEWL
A0A2K5CA52_BCL2L11      AF---NHYLSAMASMR---------------QSQAEPAGMRPEIWIAQEL
A0A2K5CA52_BCL2L11      AF---NHYLSAMVREI---------------EEVVV--------------
A0A2K5CA52_BCL2L11      AF---NHYLSAMADWD----------------------------------
A0A2K5CA52_BCL2L11      AF---NHYLSAMGIFE----------------------------------
A0A2K5CA52_BCL2L11      AF---NHYLSAMASMR---------------QSQAEPAGMRPEIWIAQEL
A0A2K5CA52_BCL2L11      AF---NHYLSAMASMR---------------QSQAEPAGMRPEIWIAQEL
A0A2K5CA52_BCL2L11      AF---NHYLSAMASMR---------------QSQAEPAGMRPEIWIAQEL
A0A2K5CA52_BCL2L11      AF---NHYLSAMASMR---------------QSQAEPAGMRPEIWIAQEL
A0A2K5BYA0_HRK-01       --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
                                                                          

A0A2K5CFK7_PMAIP1-      ----------------------------------------------
A0A2K5CLG5_BIK-01       ----------------------------------------------
A0A2K5E6A6_BAD-01       TQVIQSWWDRNLGRGGSAPSQ-------------------------
A0A2K5E6A6_BAD-03       ----------------------------------------------
A0A2K5E6A6_BAD-02       ----------------------------------------------
A0A2K5F6X4_BBC3-03      ----------------------------------------------
A0A2K5CA52_BCL2L11      ----------------------------------------------
A0A2K5CA52_BCL2L11      AKSS------------------------------------------
A0A2K5CA52_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
A0A2K5CA52_BCL2L11      ----------------------------------------------
A0A2K5CA52_BCL2L11      ----------------------------------------------
A0A2K5CA52_BCL2L11      ----------------------------------------------
A0A2K5CA52_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
A0A2K5CA52_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
A0A2K5CA52_BCL2L11      RRIGDEFNAYYPRRLEK-----------------------------
A0A2K5CA52_BCL2L11      RRIGDEFNAYYPRRISLPSD--------------------------
A0A2K5BYA0_HRK-01       ----------------------------------------------
A0A2K5F6X4_BBC3-01      ----------------------------------------------
A0A2K5F6X4_BBC3-02      ----------------------------------------------
A0A2K5E1Q4_BMF-02       ----------------------------------------------
A0A2K5E1Q4_BMF-01       ----------------------------------------------
                                                                      

© 1998-2022Legal notice