Dataset for protein classical BH3-containing proteins of organism Anolis carolinensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mdppgyldddfstldgleddvfhaedcglasqpsemtfpgiftqsksyncllgrfqlfplthccgpgsrqarqqdkatqt
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              * :*. *.*:::     .
lnpssssqdvmlpcgvteepqrlfygnagyrlhvspigfslnphfqeepqespqelrtevqiArkLqcIaDqfhrlhlqr
-------------------------------------------------------sqvaiwc qq rv g kwnls---q
                                               m gleshkmep ae  le  r   e  ar cp 
                                                                                
                                                                                

       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
.                                                                         
h--n-----w-------------iffflsnvalnmeanrhragr------------------------------
rqq-rnqvw-qssergwadpscgvltwrhkikcrnrll------svyttyvyhtfppvsprfsemlprfcleai
    mglll t            cknmikctiqpipiekpkmqfrltismfpfaeiklcfp             
                         h     f cg g glcgp qchar                         
                                            k                             
© 1998-2022Legal notice