Dataset for protein classical BH3-containing proteins of organism Anolis carolinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A803SZ00_BMF-02       MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNC
A0A803SZ00_BMF-03       MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNC
A0A803SZ00_BMF-01       MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNC
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A803TSK5_PMAIP1-      --------------------------------------------------
                                                                          

A0A803SZ00_BMF-02       LLGRFQLFPLTHCCGPGSRQARQQDKATQTLNPSSSSQDVMLPCGVTEEP
A0A803SZ00_BMF-03       LLGRFQLFPLTHCCGPGSRQARQQDKATQTLNPSSSSQDVMLPCGVTEEP
A0A803SZ00_BMF-01       LLGRFQLFPLTHCCGPGSRQARQQDKATQTLNPSSSSQDVMLPCGVTEEP
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A803TSK5_PMAIP1-      --------------------------------------------------
                                                                          

A0A803SZ00_BMF-02       QRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIA
A0A803SZ00_BMF-03       QRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIA
A0A803SZ00_BMF-01       QRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIA
A0A803SRF0_BCL2L11      -----------------------------------MQPEIWIAQELRRIG
A0A803TSK5_PMAIP1-      ---------------------------MPGLESHKSEVAAECALQLRVIG
                                                                  * :*. *.

A0A803SZ00_BMF-02       DQFHRLHLQRHQQNRNQVWWQ------------IFFFLHNVALNMEANRH
A0A803SZ00_BMF-03       DQFHRLHLQRHQQNRNQVWWQ------------IFFFLHNVALNMEANRH
A0A803SZ00_BMF-01       DQFHRLHLQRH--NMGLLLWTSSERGWADPSCGCFTWRSCTKQRIELNGP
A0A803SRF0_BCL2L11      DEFNASHCPRR----------------------VKHFLKKIICCNPILKL
A0A803TSK5_PMAIP1-      DKWNLR---QR----------------------ILNMISKIFCPGRGE--
                        *:::     ..                                       

A0A803SZ00_BMF-02       RAGRSCTTTYFPFTEPPVCFPFSEMLPRFCLEAI
A0A803SZ00_BMF-03       RAGRR-----------------------------
A0A803SZ00_BMF-01       KGPFQLYAS-------------------------
A0A803SRF0_BCL2L11      CMQRKVHIRMVYHAFIKLSPR-------------
A0A803TSK5_PMAIP1-      ----------------------------------
                                                          

© 1998-2022Legal notice