Dataset for protein classical BH3-containing proteins of organism Anolis carolinensis

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A803SRF0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anolis carolinensis GN=BCL2L11 (length=64 residues).
MQPEIWIAQELRRIGDEFNASHCPRRVKHFLKKIICCNPILKLCMQRKVHIRMVYHAFIKLSPR
>gnl|bcl2dbpro|A0A803SZ00_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Anolis carolinensis GN=BMF (length=222 residues).
MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRQARQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQR
HQQNRNQVWWQIFFFLHNVALNMEANRHRAGRSCTTTYFPFTEPPVCFPFSEMLPRFCLEAI
>gnl|bcl2dbpro|A0A803SZ00_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Anolis carolinensis GN=BMF (length=193 residues).
MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRQARQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQR
HQQNRNQVWWQIFFFLHNVALNMEANRHRAGRR
>gnl|bcl2dbpro|A0A803SZ00_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Anolis carolinensis GN=BMF (length=207 residues).
MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRQARQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQR
HNMGLLLWTSSERGWADPSCGCFTWRSCTKQRIELNGPKGPFQLYAS
>gnl|bcl2dbpro|A0A803TSK5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Anolis carolinensis GN=PMAIP1 (length=46 residues).
MPGLESHKSEVAAECALQLRVIGDKWNLRQRILNMISKIFCPGRGE
© 1998-2022Legal notice