Dataset for protein Bmf of organism Anolis carolinensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRQARQQDKATQT
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQR
                                                                                
                                                                                

       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*: .   : *             .::*  *         *                              
HqqnrnqvwWqiffflhnvalnmeanRhrA--------gRsct--------p------------f-l-a-
 nmg--lll ------------tsse gw dpscgcftw r--ttyipltg-pvcfpfsemlpr-q-y-s
                                           kqrfefne kg         p c e i
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice