Dataset for protein Bmf of organism Anolis carolinensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRQARQQDKATQT
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQR
                                                                                
                                                                                

       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
*  * . : *              * :   .  .:* *  ..                                
HqqNrnqvwWq------------iFfflhnvalnmEaNrhragrs-----------------------------
 -- mglll tssergwadpscgc twrsctkqri l gpkgpfrlyttyfpfteppvcfpfsemlprfcleai
                                            qctas                         
© 1998-2021Legal notice