Dataset for protein Bmf of organism Anolis carolinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H9GL49_BMF-01      MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPL
H9GL49_BMF-03      MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPL
H9GL49_BMF-02      MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPL
                   ************************************************************

H9GL49_BMF-01      THCCGPGSRQARQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFS
H9GL49_BMF-03      THCCGPGSRQARQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFS
H9GL49_BMF-02      THCCGPGSRQARQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFS
                   ************************************************************

H9GL49_BMF-01      LNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQRH--NMGLLLWTSSERGWADP
H9GL49_BMF-03      LNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQRHQQNRNQVWWQ---------
H9GL49_BMF-02      LNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQRHQQNRNQVWWQ---------
                   *****************************************  * . : *          

H9GL49_BMF-01      SCGCFTWRSCTKQRIELNGPKGPFQLYAS-------------------------
H9GL49_BMF-03      ---IFFFLHNVALNMEANRHRAGRR-----------------------------
H9GL49_BMF-02      ---IFFFLHNVALNMEANRHRAGRSCTTTYFPFTEPPVCFPFSEMLPRFCLEAI
                       * :   .  .:* *  ..                                

© 1998-2021Legal notice