Dataset for protein Bmf of organism Anolis carolinensis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|H9GL49_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Anolis carolinensis GN=BMF (length=193 residues).
MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRQARQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQR
HQQNRNQVWWQIFFFLHNVALNMEANRHRAGRR
>gnl|bcl2dbpro|H9GL49_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Anolis carolinensis GN=BMF (length=207 residues).
MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRQARQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQR
HNMGLLLWTSSERGWADPSCGCFTWRSCTKQRIELNGPKGPFQLYAS
>gnl|bcl2dbpro|H9GL49_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Anolis carolinensis GN=BMF (length=222 residues).
MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRQARQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQR
HQQNRNQVWWQIFFFLHNVALNMEANRHRAGRSCTTTYFPFTEPPVCFPFSEMLPRFCLEAI
© 1998-2022Legal notice