Dataset for protein classical BH3-containing proteins of organism Anas zonorhyncha

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mdrpsyleedyssldgldddvfhsddfglagqpgemtatgiftqnqsyscllgrfqlfplthccgpgvrhpeqqdkatqt
                                                                  ssss ssssa arp
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                         .     :  *  :.*        
-------------------------gnagyrlhvppvgfaldphlqeepqegqqearaevq-iarkLqcigDqfhrlh--
lspssssqdvmlpcgvteeprrlfy------------------------lqqtetrqpviwavsqe rrma lmqvsqpc
v  c ppraqpp a           spgpfatrs lfi  mrsrtprscdkpsa ps pce c ly sa   kanfry  
                                        epcpalmk ahaa  i   a          e da    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------iqrh-------w---flfllnlalnveanrn-------------------------------------------
vantrg----qqnrnqv-wql----h-----l-----htgqswrlalrqvfrslkcrkgcaggcihpgagacclrcgvar
      tp vgcwsrgr rviwfty-svvtl-vssktqpsrrlp                                    
      ca r  fqcaa grg  ripgis kkpgk hklnhlhk                                    
         q                  i h fch e    i                                      

       250       260       270         
....:....|....:....|....:....|....:....
                                       
---------------------------------------
ccsvtkrtqshqrvgtgdfqlsqlcsqyqepvkhglllq
                                eeagfqg
                                 a  c  
                                       
© 1998-2022Legal notice