Dataset for protein classical BH3-containing proteins of organism Anas zonorhyncha

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A8B9UZ84_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Anas zonorhyncha GN=PMAIP1 (length=51 residues).
MPCRTLRKPAQPSAERQAVAECALELRRIGDKADFRQRILNLITKLFCHKT
>gnl|bcl2dbpro|A0A8B9VI07_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Anas zonorhyncha GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQR
>gnl|bcl2dbpro|A0A8B9VI07_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Anas zonorhyncha GN=BMF (length=126 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIADQFHR
LHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNHTGQSHRKEGLFL
>gnl|bcl2dbpro|A0A8B9VI07_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Anas zonorhyncha GN=BMF (length=199 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIADQFHRLHIQR
VGCFQRGRWGLTYPGVVLLKPGSRHQPSRLLPEAAGCQQ
>gnl|bcl2dbpro|A0A8B9VVW8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anas zonorhyncha GN=BCL2L11 (length=132 residues).
LHQAEEIQPEIWIAQELRRIGDEFNASYCPRRVIFLFLLSISLHLVSKREKLNHIWKLALRQVFRSLKCRKGCAGGCIHP
GAGACCLRCGVARCCSVTKRTQSHQRVGTGDFQLSQLCSQYQEPVKHGLLLG
>gnl|bcl2dbpro|A0A8B9VXZ3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anas zonorhyncha GN=BCL2L11 (length=106 residues).
SSSSPSSSSAAARPVSPCSPPRAQPPPASPGPFATRSPLFIFAERSPAPMSCDKATQTPSPPCQAVSHYLSAMGDLMQVS
QPCVANTRGTARQGCWSCAAWRRGWF
© 1998-2022Legal notice