Dataset for protein classical BH3-containing proteins of organism Anas zonorhyncha

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9UZ84_PMAIP1-      --------------------------------------------------
A0A8B9VXZ3_BCL2L11      --------------------------------------------------
A0A8B9VI07_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8B9VI07_BMF-02       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A8B9VI07_BMF-03       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLA--------------------
A0A8B9VVW8_BCL2L11      --------------------------------------------------
                                                                          

A0A8B9UZ84_PMAIP1-      --------------------------------------------------
A0A8B9VXZ3_BCL2L11      ----------------SSSSPSSSSAAARPVSPCSPPRAQPPPA------
A0A8B9VI07_BMF-01       LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8B9VI07_BMF-02       LLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A8B9VI07_BMF-03       --------------------------------------------------
A0A8B9VVW8_BCL2L11      --------------------------------------------------
                                                                          

A0A8B9UZ84_PMAIP1-      --------------------MPCRTLRKPAQPSAERQAVAE-CALELRRI
A0A8B9VXZ3_BCL2L11      -----SPGPFATRSPLFIFAERSPAPMSCDKATQTPSPPCQAVSHYLSAM
A0A8B9VI07_BMF-01       RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQ-IARKLQCI
A0A8B9VI07_BMF-02       RRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQ-IARKLQCI
A0A8B9VI07_BMF-03       -----GNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQ-IARKLQCI
A0A8B9VVW8_BCL2L11      -----------------------------LHQAEEIQPEIW-IAQELRRI
                                                             .     :  *  :

A0A8B9UZ84_PMAIP1-      GDKADFRQ-------------------------RILNLITKLFCHKT---
A0A8B9VXZ3_BCL2L11      GDLMQVSQPCVANTRGTARQGCWSCAAWRRGWF-----------------
A0A8B9VI07_BMF-01       ADQFHRLH--------IQRHQQNRNQVWWQLFLFLHNLALNVEANRNHTG
A0A8B9VI07_BMF-02       ADQFHRLH--------IQRVGCFQRGRWG---LTYPGVVLLKPGSRHQPS
A0A8B9VI07_BMF-03       ADQFHRLH--------IQRHQQNRNQVWWQLFLFLHNLALNVEANRNHTG
A0A8B9VVW8_BCL2L11      GDEFNASY--------CPRR---------VIFLFLLSISLHLVSKREKLN
                        .*                                                

A0A8B9UZ84_PMAIP1-      --------------------------------------------------
A0A8B9VXZ3_BCL2L11      --------------------------------------------------
A0A8B9VI07_BMF-01       QR------------------------------------------------
A0A8B9VI07_BMF-02       RLLP----------------------------------------------
A0A8B9VI07_BMF-03       QSHR----------------------------------------------
A0A8B9VVW8_BCL2L11      HIWKLALRQVFRSLKCRKGCAGGCIHPGAGACCLRCGVARCCSVTKRTQS
                                                                          

A0A8B9UZ84_PMAIP1-      -----------------------------
A0A8B9VXZ3_BCL2L11      -----------------------------
A0A8B9VI07_BMF-01       -----------------------------
A0A8B9VI07_BMF-02       ----------------------EAAGCQQ
A0A8B9VI07_BMF-03       ----------------------KEGLFL-
A0A8B9VVW8_BCL2L11      HQRVGTGDFQLSQLCSQYQEPVKHGLLLG
                                                     

© 1998-2022Legal notice