Dataset for protein Bim of organism Anas zonorhyncha

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
       .:   .*    :    .      ..:..*  :*:*                        .   .:.* *.   
ssssplhqaaaaq eipcapelaqigdafnapfap rpi i llsislhlvskreklnhiwklaaeqsfaplk d acag

        90       100       110       120       130       140  
 .    * :  * .      *:. * ...*  :.*   :        *: :    ..* :  
gcihcg gacc ramgdlmg aqc sank gqah gcgsgdfqlsql aawqepvkh lflg
© 1998-2023Legal notice