Dataset for protein Bim of organism Anas zonorhyncha

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9VVW8_BCL2L11      -----LHQAEEIQPEIWIAQELRRIGDEFNASYCPRRVIFLFLLSISLHL
A0A8B9VXZ3_BCL2L11      SSSSPSSSSAAARPVSPCSPPRAQPPPASPGPFATRSPLFIF--------
                               .:   .*    :    .      ..:..*  :*:*        

A0A8B9VVW8_BCL2L11      VSKREKLNHIWKLALRQVFRSLKCRKGCAGGCIHPGAGACCLRC-----G
A0A8B9VXZ3_BCL2L11      --------------AERSPAPMSCDKATQTPSPPCQAVSHYLSAMGDLMQ
                                        .   .:.* *.    .    * :  * .      

A0A8B9VVW8_BCL2L11      VARCCSVTKRTQSHQRVGTGDFQLSQLCSQYQEPVKHGLLLG
A0A8B9VXZ3_BCL2L11      VSQPCVANTRGTARQGCWS--------CAAW----RRGWF--
                        *:. * ...*  :.*   :        *: :    ..* :  

© 1998-2022Legal notice