Dataset for protein Bim of organism Anas zonorhyncha

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8B9VVW8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anas zonorhyncha GN=BCL2L11 (length=132 residues).
LHQAEEIQPEIWIAQELRRIGDEFNASYCPRRVIFLFLLSISLHLVSKREKLNHIWKLALRQVFRSLKCRKGCAGGCIHP
GAGACCLRCGVARCCSVTKRTQSHQRVGTGDFQLSQLCSQYQEPVKHGLLLG
>gnl|bcl2dbpro|A0A8B9VXZ3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anas zonorhyncha GN=BCL2L11 (length=106 residues).
SSSSPSSSSAAARPVSPCSPPRAQPPPASPGPFATRSPLFIFAERSPAPMSCDKATQTPSPPCQAVSHYLSAMGDLMQVS
QPCVANTRGTARQGCWSCAAWRRGWF
© 1998-2022Legal notice