Dataset for protein classical BH3-containing proteins of organism Amazona collaria

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mdrpsyleedyssldgldddvfhsddfglagqpgemtatgiftqnqsyscllgrfqlfplthccgpgirhpeqqdkatqt

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  *..:....  * . :                                     ** .  : * :*. *.*:        
-sPsstsrkvmlPtgvt-------------------------------------EArvvvqiArqLrrIgDq--------
lm gkspqdaaa capaeeprrlfygnagyrlhippadfaldphlqeepqegqr  eaesec lk qc a kfhrlhiqr

       170       180       190   
....:....|....:....|....:....|...
         *:*   : **     :.. .  : 
---------WqLrqkllNL-----vtrnhtpqt
hqqnrnqvw n flfih  alnaelnklfcger
© 1998-2022Legal notice