Dataset for protein classical BH3-containing proteins of organism Amazona collaria

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8B9EVZ5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Amazona collaria GN=PMAIP1 (length=53 residues).
MPGKTPRKAAAPTAPAEAEVVSECALQLRRIGDKWNLRQKILNLLTKLFCPET
>gnl|bcl2dbpro|A0A8B9FZ48_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Amazona collaria GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHIPPADFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNAEVNRNHTGQR
© 1998-2022Legal notice