Dataset for protein classical BH3-containing proteins of organism Amazona collaria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9EVZ5_PMAIP1-      --------------------------------------------------
A0A8B9FZ48_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                                                                          

A0A8B9EVZ5_PMAIP1-      -------------------------------MPGKTPRKAAAPTAPA---
A0A8B9FZ48_BMF-01       LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                                                        *..:....  * . :   

A0A8B9EVZ5_PMAIP1-      ----------------------------------EAEVVSECALQLRRIG
A0A8B9FZ48_BMF-01       RRLFYGNAGYRLHIPPADFALDPHLQEEPQEGQREARAEVQIARKLQCIA
                                                          ** .  : * :*. *.

A0A8B9EVZ5_PMAIP1-      DK-----------------WNLRQKILNL-----LTKLFCPET
A0A8B9FZ48_BMF-01       DQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNAEVNRNHTGQR
                        *:                 *:*   : **     :.. .  : 

© 1998-2022Legal notice