Dataset for protein classical BH3-containing proteins of organism Ailuropoda melanoleuca

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
trtwgggsrqgsrgvrsgtepgratlagtcwvrktpaavaagaarrgefvnnrlafggltrrrrlrrrrllavarsdrar
pasa a p      aaaag a   gg faarslea   a  a  fg                                  
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
anwgrgrpcprarggrrgrrrrgqwvrrsgrxsealscpavrvslrsasprlcpspglvnaprpyvplrslradvaglpp
   ea haa a ga l cgga adca al  qa   g g eqggg a qg   aal almmspggslwpqypsvsssgll
                                                           kfl aacfmkpekpthqmhfg
                                                                    gm    gh a e
                                                                          e    a
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------makqpsdv-ssec--dreggqlqpaerppq
rgrttaarrrcgcytrpapargpwapsprvlstpdpvetlwrdgsrkkdls-----eme----ve---ddvf--edge-g
wrprsqscqparssrstrtsqywmsrarqpgvslelgagplhkdpepftq-wsvvg--sppq   elr--g-pa---- -
sqtprcrsngpparpqiqrretstptpwwesnvspfwleaashnrtaephtrlh rat cgl   rg ep-aagrpaa a
gfsmp g id i llpc  mdsls gfqsl gpqcctks glrehiqta llta pr            s       r r
 a ig    a   aa    laa i        a   c    a  ga     fr                           
   ae                                       a                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lrpgaptslqteqq--------------------------------------------------------drspapmscd
tq--sll---l-a-sqldgpgsrlplfppthccgpglrptsqetrsplfifvrrssllsrsssgyfsfdtqpatqtlepa
--aa---cad-f-rgppgceldhchqpslqgppa pas gpfa                           -k-ls-g-sh
gl   ypavykrggwngevv rdhapg  rlfl                                     m-n--sakq-
     g  hr l  reea a a   n                                            iggkla- - 
                a                                                     ad  k r   
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      .  *  :.*.
kssqtpsppcqafnh------------------yl-------------samasmrqsqavpadmrpeiwiaqeLrrigDe
sptpgvmla------pqrlfygnagyrlplpas--qehgpevlevpgmaglplge-ppeg-wqhqaavecgrq qcma q
le--vaaa-ggvteereemshtgpls nlflstfp             -------a-g--g----wdrqv ik aff  k
-aat---- aalsda                                 tdgvtqad -vr eeen  -d  ar      d
q-  srtt   t                                        eyy   ps nsne             
p   i                                                                           
    a                                                                           

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:                                                                               
fnayyprrvq------n-y-----------------------------------------------------wrvllylv
lhrlhmq--feerqrl-n-qaaeahpqmgprtvlrwqvhgltntspnvrvwsfstqsntvspsplrgsvliilql-rnii
me-----qr-g lpgqrqnrldstynrtalegcgpslrd ikclregrnilkdlafrgrfclhkgcclckvw--- -f-h
  vrwelphv     hapsp  fgl  i                                          sfrpk y-p-
        ll     v mgs                                                  mlnlh gp l
        ga     m a a                                                        fl  
                                                                                

       490        
....:....|....:...
                  
rlvwrlq-----------
s-llnaprnrngagprpn
nkafpsdegylapeme  
-g--hwgtslgpnlg   
mwr  ilqr  c      
g g   hs          
      ea          
© 1998-2022Legal notice