Dataset for protein classical BH3-containing proteins of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N5JEA5_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A7N5KJL4_BBC3-01      --------------------------------------------------
A0A7N5KJL4_BBC3-02      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5KDU2_BIK-01       --------------------------------------------------
A0A7N5JI49_BMF-03       --------------------------------------------------
A0A7N5JI49_BMF-01       --------------------------------------------------
A0A7N5JI49_BMF-02       --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      PATWGGGSRQGSRGVRAGTEAGRAGGAGAARVRETPAAVAAGAAFGGEFV
A0A7N5JE15_BCL2L11      TRSAGAGP------AASAGEPGRATLAFTCWSLKAPAAAAAAAARRG---
                                                                          

A0A7N5JEA5_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A7N5KJL4_BBC3-01      --------------------------------------------------
A0A7N5KJL4_BBC3-02      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5KDU2_BIK-01       --------------------------------------------------
A0A7N5JI49_BMF-03       --------------------------------------------------
A0A7N5JI49_BMF-01       --------------------------------------------------
A0A7N5JI49_BMF-02       --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      NNRLAFGGLTRRRRLRRRRLLAVARSDRARANWERGHPAPAARGGRRCRR
A0A7N5JE15_BCL2L11      ---------------------------------GAGRACPRAGAGLRGGG
                                                                          

A0A7N5JEA5_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A7N5KJL4_BBC3-01      --------------------------------------------------
A0A7N5KJL4_BBC3-02      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5KDU2_BIK-01       -----------------------------------------------MGM
A0A7N5JI49_BMF-03       --------------------------------------------------
A0A7N5JI49_BMF-01       ---------------------------------------MFPR-------
A0A7N5JI49_BMF-02       ----------------------------------------MPRAGVFWKQ
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      RRAQCARRSGRXAEALGCPAERGGGRAASGRLCAAPGALNASPGYCLLRS
A0A7N5JE15_BCL2L11      ARGDWVRALGRQSE-LSCGAVQVSLRSAQP---PSLGLVKALRPASPLPP
                                                                          

A0A7N5JEA5_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A7N5KJL4_BBC3-01      ---------------------------------MARARQEGSSPEPVEGL
A0A7N5KJL4_BBC3-02      ---------------------------------MARARQEGSSPEPVEGL
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5KDU2_BIK-01       EKSTVASGLLGGRMGQSCQDPGSYTQIQPLDSSTSTPWRLLNAPPCWETA
A0A7N5JI49_BMF-03       -----------------------------MRAWW----------------
A0A7N5JI49_BMF-01       ----EAGLFPSFPIE------------------WAPSPRVLVTLDPGAEP
A0A7N5JI49_BMF-02       YRAVHSGLLPRQPASCRRRPCPCLPPPATRRGPWAPSPRVLVTLDPGAEP
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      ------MGPEWGTRPAACNRCICARSCAPAQYLIPGSQSPLGVSDFCKSA
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      LRADGQGAPGRRRTRAGRRGARARARTRRSEG------------------
A0A7N5JE15_BCL2L11      LPPDSHSHPARASPTAASIAAGCSLRPAPAATPSAPFPWPSSPQCLTLTL
                                                                          

A0A7N5JEA5_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A7N5KJL4_BBC3-01      ARDGPRPFPLSRLVPSAVSCGLC-----EPGLPAAPAAPALLPAAYLCHR
A0A7N5KJL4_BBC3-02      ARDGPRPFPLSRLVPSAVSCGLC-----EPGLPAAPAAPALLPAAYL---
A0A7N5JE15_BCL2L11      ----------MAKQPSDV-SSEC--DREGGQLQPAERPPQLRPGAPTSLQ
A0A7N5KDU2_BIK-01       LADGGAQTAHTFTQPPRT-------RGRGSGAAGRERRPRGRAGAGPAVY
A0A7N5JI49_BMF-03       ---------LLLRAVREMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSAD
A0A7N5JI49_BMF-01       WHHDSEAETLSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSAD
A0A7N5JI49_BMF-02       WHHDSEAETLSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSAD
A0A7N5JE15_BCL2L11      ----------MAKQPSDV-SSEC--DREGGQLQPAERPPQLRPGAPTSLQ
A0A7N5JE15_BCL2L11      ----------MAKQPSDV-SSEC--DREGGQLQPAERPPQLRPGAPTSLQ
A0A7N5JE15_BCL2L11      LSKEHIKKDQMAKQPSDV-SSEC--DREGGQLQPAERPPQLRPGAPTSLQ
A0A7N5JE15_BCL2L11      ----------MAKQPSDV-SSEC--DREGGQLQPAERPPQLRPGAPTSLQ
A0A7N5JE15_BCL2L11      --KGRTKKDQMAKQPSDV-SSEC--DREGGQLQPAERPPQLRPGAPTSLQ
A0A7N5JE15_BCL2L11      GLRNARKKDQMAKQPSDV-SSEC--DREGGQLQPAERPPQLRPGAPTSLQ
                                                                          

A0A7N5JEA5_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A7N5KJL4_BBC3-01      LRGGSEGGGAGRHLPNPSP---PGP-------------------------
A0A7N5KJL4_BBC3-02      ----WPAGVVGADHAPPPPRLFPGP-------------------------
A0A7N5JE15_BCL2L11      TEQQ----------------------------------------------
A0A7N5KDU2_BIK-01       KLARRPEA------------------------------------------
A0A7N5JI49_BMF-03       LFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQE-----------------
A0A7N5JI49_BMF-01       LFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQE-----------------
A0A7N5JI49_BMF-02       LFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQE-----------------
A0A7N5JE15_BCL2L11      TEQQ----------------------------------------------
A0A7N5JE15_BCL2L11      TEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSR
A0A7N5JE15_BCL2L11      TEQQ----------------------------------------------
A0A7N5JE15_BCL2L11      TEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSR
A0A7N5JE15_BCL2L11      TEQQ----------------------------------------------
A0A7N5JE15_BCL2L11      TEQQ----------------------------------------------
                                                                          

A0A7N5JEA5_PMAIP1-      ----------MPGKKARKSAQASPARTPA---------------------
G1LIZ7_PMAIP1-01        ----------IGSLLSGEPASPSPSAAPP---------------------
A0A7N5KJL4_BBC3-01      ----------QPSLSPAEQHLESPVPSAPGAL------------------
A0A7N5KJL4_BBC3-02      ----------QPSLSPAEQHLESPVPSAPGAL------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5KDU2_BIK-01       ----------ADNTAPGSSAPAATIAATAAATSDAREEMSHTGPLSRNLF
A0A7N5JI49_BMF-03       ----------DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A7N5JI49_BMF-01       ----------DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A7N5JI49_BMF-02       ----------DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A7N5JE15_BCL2L11      ----------DRSPAPMSCDKSTQTPSPPCQAFNH---------------
A0A7N5JE15_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH---------------
A0A7N5JE15_BCL2L11      ----------DRSPAPMSCDKSTQTPSPPCQAFNH---------------
A0A7N5JE15_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNH---------------
A0A7N5JE15_BCL2L11      ----------DRSPAPMSCDKSTQTPSPPCQAFNH---------------
A0A7N5JE15_BCL2L11      ----------DRSPAPMSCDKSTQTPSPPCQAFNH---------------
                                                                          

A0A7N5JEA5_PMAIP1-      ----------------------------------EPEVECAIQLRRFGDK
G1LIZ7_PMAIP1-01        -----------------------------------PEVECAIQLRRFGDK
A0A7N5KJL4_BBC3-01      ------------------AGGPTQAAPGVRGEEEQWAREIGAQLRRMADD
A0A7N5KJL4_BBC3-02      ------------------AGGPTQAAPGVRGEEEQWAREIGAQLRRMADD
A0A7N5JE15_BCL2L11      ---------------------ASMRQSQAVPADMRPEIWIAQELRRIGDE
A0A7N5KDU2_BIK-01       LSTFLQEHGPEVLEVPGMTDLVEYYDPGPSPNSNNPD-DVAMRLAFIGDE
A0A7N5JI49_BMF-03       PASFP-------------AGLPLGEQPPEGPWQHRAEVQIARKLQCIADQ
A0A7N5JI49_BMF-01       PASFP-------------AGLPLGEQPPEGPWQHRAEVQIARKLQCIADQ
A0A7N5JI49_BMF-02       PASFP-------------AGLPLGEQPPEGPWQHRAEVQIARKLQCIADQ
A0A7N5JE15_BCL2L11      ---YL-------------SAMASMRQSQAVPADMRPEIWIAQELRRIGDE
A0A7N5JE15_BCL2L11      ---YL-------------SAMASMRQSQAVPADMRPEIWIAQELRRIGDE
A0A7N5JE15_BCL2L11      ---YL-------------SAMASMRQSQAVPADMRPEIWIAQELRRIGDE
A0A7N5JE15_BCL2L11      ---YL-------------SAMASMRQSQAVPADMRPEIWIAQELRRIGDE
A0A7N5JE15_BCL2L11      ---YL-------------SAMASMRQSQAVPADMRPEIWIAQELRRIGDE
A0A7N5JE15_BCL2L11      ---YL-------------SAMASMRQSQAVPADMRPEIWIAQELRRIGDE
                                                                .  *  :.*.

A0A7N5JEA5_PMAIP1-      LN------------------------------------------------
G1LIZ7_PMAIP1-01        LN------------------------------------------------
A0A7N5KJL4_BBC3-01      LNALYERRRQEERQRHRPSP------------------------------
A0A7N5KJL4_BBC3-02      LNALYERRRQEERQRHRPSP------------------------------
A0A7N5JE15_BCL2L11      FNAYYPRRLA----------------------------------------
A0A7N5KDU2_BIK-01       MEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSLVDGLTNLRENVRI
A0A7N5JI49_BMF-03       FHRLHMQQHQ-----QNQNR------------------------------
A0A7N5JI49_BMF-01       FHRLHMQQHQ-----QNQNR------------------------------
A0A7N5JI49_BMF-02       FHRLHMQQHQ-----QNQNR------------------------------
A0A7N5JE15_BCL2L11      FNAYYPRRGL-----VAAGAADSGLPRIAPETCGPWQRHGIKCTSPGRNV
A0A7N5JE15_BCL2L11      FNAYYPR-------------------------------------------
A0A7N5JE15_BCL2L11      FNAYYPRRVF-----LNNYQAAEAHPQM----------------------
A0A7N5JE15_BCL2L11      FNAYYPRRVF-----LNNYQAAEAHPQM----------------------
A0A7N5JE15_BCL2L11      FNAYYPRRVF-----LNNYQAAEAHPQM----------------------
A0A7N5JE15_BCL2L11      FNAYYPRRVF-----LNNYQAAEAHPQM----------------------
                        :                                                 

A0A7N5JEA5_PMAIP1-      ---------------------FRQKLLNLISKLFRSGT----------
G1LIZ7_PMAIP1-01        ---------------------FRQKLLNLISKLFRSGT----------
A0A7N5KJL4_BBC3-01      ----------------------WRVLYNLIMGLLPLPRGRGAPEMEPN
A0A7N5KJL4_BBC3-02      ----------------------WRVLYNLIMGLLPLPRGRGAPEMEPN
A0A7N5JE15_BCL2L11      ----------------------------------RIPASYLC------
A0A7N5KDU2_BIK-01       WSFLTFRNRVSPHPGRGLVLSLLLLLGLLLGWGFRLLQ----------
A0A7N5JI49_BMF-03       --------------------VWWQVLLFLHNLALNADENRNGAGPR--
A0A7N5JI49_BMF-01       --------------------VWWQVLLFLHNLALNADENRNGAGPR--
A0A7N5JI49_BMF-02       --------------------VWWQVLLFLHNLALNADENRNGAGPR--
A0A7N5JE15_BCL2L11      LKDSAQSGTFCLSKLCCSCKMFNPHLFPPVSLRWHWHSRLLPNLG---
A0A7N5JE15_BCL2L11      ----------------------------------RLEQ----------
A0A7N5JE15_BCL2L11      --------------------IILRLLRYIVRLVWRLQ-----------
A0A7N5JE15_BCL2L11      --------------------IILRLLRYIVRLVWRLQR----------
A0A7N5JE15_BCL2L11      --------------------IILRLLRYIVRLVWRLQ-----------
A0A7N5JE15_BCL2L11      --------------------IILRLLRYIVRLVWRLQ-----------
                                                                        

© 1998-2022Legal notice