Dataset for protein classical BH3-containing proteins of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1LIZ7_PMAIP1-01       -------------MPGKKA-------------------------------
G1LNV7_BBC3-01         -------------GSGARGDPISRPQAQVWKLRPRCVTGGKHRLRG----
G1LDR8_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPP----QLRPGAPTSLQTEQQG----
G1MI17_BAD-01          VGTPENPSSAPTHGPGKRKSGTDRRE----TRKGPRTTALAPTAQSMFQI
                                      * .                                

G1LIZ7_PMAIP1-01       --------------------------------------------------
G1LNV7_BBC3-01         -----------GSEGGGAGRHLPNPSPPGPQPSLSPAEQHL---------
G1LDR8_BCL2L11-01      ---NPEGEGDRCPQGSPQGPLA---PPASPGPFATRSPLFI------FVR
G1MI17_BAD-01          PEFEPSEQEDSSPADRGLGPSPTGDQPPGPGKHRQTAPGLLGEAAHPQGQ
                                                                         

G1LIZ7_PMAIP1-01       ------------------RKSAQASPARTRGQPEVEC-------------
G1LNV7_BBC3-01         ------------------ESPVPSAPGALAGGPTQAAPGVR---------
G1LDR8_BCL2L11-01      RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASM
G1MI17_BAD-01          PASSNHHGGAGAVEPRSRHSSYPAGTEEDEGLEEEELSPFR---------
                                          ..   .                         

G1LIZ7_PMAIP1-01       ----------------AIQLRRFGDKLN----------------------
G1LNV7_BBC3-01         GEEEQWAREI------GAQLRRMADDLNALYER-----RRQEERQRHRPS
G1LDR8_BCL2L11-01      RQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMI
G1MI17_BAD-01          GRSSSAPPNLCAALRYGRELRRMSDEFQGSFKG---LPRPKSAGTATQMR
                                       . :***:.*.::                      

G1LIZ7_PMAIP1-01       FRQKLLNLISKLFRSGT----------
G1LNV7_BBC3-01         PWRVLYNLIMGLLPLPRGRGAPEMEPN
G1LDR8_BCL2L11-01      ILRLLRYIVRLVWRLQ-----------
G1MI17_BAD-01          QSPSWTRVIQSWWDRNLGRGGSAPSQ-
                              ::                  

© 1998-2020Legal notice