Dataset for protein classical BH3-containing proteins of organism Ailuropoda melanoleuca

[Download (right click)] [Alignment] [Repertoires]

15 sequence(s)

>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=330 residues).
PATWGGGSRQGSRGVRAGTEAGRAGGAGAARVRETPAAVAAGAAFGGEFVNNRLAFGGLTRRRRLRRRRLLAVARSDRAR
ANWERGHPAPAARGGRRCRRRRAQCARRSGRXAEALGCPAERGGGRAASGRLCAAPGALNASPGYCLLRSLRADGQGAPG
RRRTRAGRRGARARARTRRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSC
DKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLR
YIVRLVWRLQ
>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=194 residues).
MGPEWGTRPAACNRCICARSCAPAQYLIPGSQSPLGVSDFCKSALSKEHIKKDQMAKQPSDVSSECDREGGQLQPAERPP
QLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYP
RRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQR
>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=304 residues).
TRSAGAGPAASAGEPGRATLAFTCWSLKAPAAAAAAAARRGGAGRACPRAGAGLRGGGARGDWVRALGRQSELSCGAVQV
SLRSAQPPSLGLVKALRPASPLPPLPPDSHSHPARASPTAASIAAGCSLRPAPAATPSAPFPWPSSPQCLTLTLGLRNAR
KKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQ
SQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=88 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLA
RIPASYLC
>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=190 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRGLVAAGAADSGLPRIAPETCGPWQRHGIKCTSPGRNVLKDSAQSGTFCLSKL
CCSCKMFNPHLFPPVSLRWHWHSRLLPNLG
>gnl|bcl2dbpro|A0A7N5JEA5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=PMAIP1 (length=54 residues).
MPGKKARKSAQASPARTPAEPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|A0A7N5JI49_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BMF (length=261 residues).
MPRAGVFWKQYRAVHSGLLPRQPASCRRRPCPCLPPPATRRGPWAPSPRVLVTLDPGAEPWHHDSEAETLSWSHPGEMEP
PQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVM
LPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQV
LLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|A0A7N5JI49_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BMF (length=233 residues).
MFPREAGLFPSFPIEWAPSPRVLVTLDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLS
ADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFP
AGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQVLLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|A0A7N5JI49_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BMF (length=197 residues).
MRAWWLLLRAVREMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQED
KATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRL
HMQQHQQNQNRVWWQVLLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|A0A7N5KDU2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BIK (length=281 residues).
MGMEKSTVASGLLGGRMGQSCQDPGSYTQIQPLDSSTSTPWRLLNAPPCWETALADGGAQTAHTFTQPPRTRGRGSGAAG
RERRPRGRAGAGPAVYKLARRPEAADNTAPGSSAPAATIAATAAATSDAREEMSHTGPLSRNLFLSTFLQEHGPEVLEVP
GMTDLVEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSLVDGLTNLREN
VRIWSFLTFRNRVSPHPGRGLVLSLLLLLGLLLGWGFRLLQ
>gnl|bcl2dbpro|A0A7N5KJL4_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BBC3 (length=180 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLWPAGVVGADHAPPPPRLFPGP
QPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEERQRHRPSPWRVLYN
LIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A7N5KJL4_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BBC3 (length=184 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCHRLRGGSEGGGAGRHLPNPS
PPGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEERQRHRPSPWR
VLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|G1LIZ7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=PMAIP1 (length=53 residues).
IGSLLSGEPASPSPSAAPPPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT
© 1998-2022Legal notice