Dataset for protein classical BH3-containing proteins of organism Ailuropoda melanoleuca

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|G1LIZ7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=PMAIP1 (length=53 residues).
IGSLLSGEPASPSPSAAPPPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|G1LNV7_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BBC3 (length=184 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCHRLRGGSEGGGAGRHLPNPS
PPGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEERQRHRPSPWR
VLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|G1LNV7_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BBC3 (length=180 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLWPAGVVGADHAPPPPRLFPGP
QPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEERQRHRPSPWRVLYN
LIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|G1MI17_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSPADRGLGPSPTGDQPPGPGKHRQTAPGLLGEAAHPQGQPASSNHHGGAGAVEPRSRHSSYPAGT
EEDEGLEEEELSPFRGRSSSAPPNLCAALRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLG
RGGSAPSQ
© 1998-2021Legal notice