Dataset for protein Bim of organism Ailuropoda melanoleuca

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
trtwgggsrqgsrgvrsgtepgratlagtcwvrktpaavaagaarrgefvnnrlafggltrrrrlrrrrllavarsdrar
pasa a p      aaaag a   gg faarslea   a  a  fg                                  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
anwgrgrpcprarggrrgrrrrgqwvrrsgrxsealscpavrvslrsasprlcpspglvnasrpysplrslrpdsqshpg
   ea haa a ga l cgga adca al  qa   g g eqggg a qg   aal alk lpgacl pp pa ghmg e
                                                                            ga a

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                  ******************************
--------------------------------------------------MAKQPSDVSSECDREGGQLQPAERPPQLRP
rrtttaasrrarcsrrtapaqypsppsqwpssvsdltltllsknrtkkdq                              
wgsrr grngciarlsprrsetliagfps lgpqcfcksaglrghr                                  
 arpp  cia g aa c   ag                     eai                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********                                                                     
GAPTSLQTEQQ--------------------------------------------------------drspapmscdkst
           gnpegegdrcpqgspqgplappaspgpfatrsplfifvrrssllsrsssgyfsfdt-------------
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 ************************************                           
qtpsppcqafnhylsamASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRrvflnnyqaaeahpqm-----------
-----------------                                    ----------------apetcgpwqrh
                                                      glvaaga dsgl ri           
                                                                                

       410       420       430       440       450      
....:....|....:....|....:....|....:....|....:....|....:.
                                             .          
-------------------------------iilrllryivrlvwrlq--------
gikctspgrnvlkdsaqsgtfclsklccsck--------------hwhrrplsylg
                               mfnph fpp s r   esilapn c
                                               aq       
© 1998-2022Legal notice