Dataset for protein Bim of organism Ailuropoda melanoleuca

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=330 residues).
PATWGGGSRQGSRGVRAGTEAGRAGGAGAARVRETPAAVAAGAAFGGEFVNNRLAFGGLTRRRRLRRRRLLAVARSDRAR
ANWERGHPAPAARGGRRCRRRRAQCARRSGRXAEALGCPAERGGGRAASGRLCAAPGALNASPGYCLLRSLRADGQGAPG
RRRTRAGRRGARARARTRRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSC
DKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLR
YIVRLVWRLQ
>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=194 residues).
MGPEWGTRPAACNRCICARSCAPAQYLIPGSQSPLGVSDFCKSALSKEHIKKDQMAKQPSDVSSECDREGGQLQPAERPP
QLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYP
RRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQR
>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=304 residues).
TRSAGAGPAASAGEPGRATLAFTCWSLKAPAAAAAAAARRGGAGRACPRAGAGLRGGGARGDWVRALGRQSELSCGAVQV
SLRSAQPPSLGLVKALRPASPLPPLPPDSHSHPARASPTAASIAAGCSLRPAPAATPSAPFPWPSSPQCLTLTLGLRNAR
KKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQ
SQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=88 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLA
RIPASYLC
>gnl|bcl2dbpro|A0A7N5JE15_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=190 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRGLVAAGAADSGLPRIAPETCGPWQRHGIKCTSPGRNVLKDSAQSGTFCLSKL
CCSCKMFNPHLFPPVSLRWHWHSRLLPNLG
© 1998-2022Legal notice