Dataset for protein Bim of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      PATWGGGSRQGSRGVRAGTEAGRAGGAGAARVRETPAAVAAGAAFGGEFV
A0A7N5JE15_BCL2L11      TRSAGAGP------AASAGEPGRATLAFTCWSLKAPAAAAAAAARRG---
                                                                          

A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      NNRLAFGGLTRRRRLRRRRLLAVARSDRARANWERGHPAPAARGGRRCRR
A0A7N5JE15_BCL2L11      ---------------------------------GAGRACPRAGAGLRGGG
                                                                          

A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      RRAQCARRSGRXAEALGCPAERGGGRAASGRLCAAPGALNASPGYCLLRS
A0A7N5JE15_BCL2L11      ARGDWVRALGRQSE-LSCGAVQVSLRSAQP---PSLGLVKALRPASPLPP
                                                                          

A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      ------MGPEWGTRPAACNRCICARSCAPAQYLIPGSQSPLGVSDFCKSA
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      LRADGQGAPGRRRTRAGRRGARARARTRRSEG------------------
A0A7N5JE15_BCL2L11      LPPDSHSHPARASPTAASIAAGCSLRPAPAATPSAPFPWPSSPQCLTLTL
                                                                          

A0A7N5JE15_BCL2L11      ----------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQ
A0A7N5JE15_BCL2L11      ----------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQ
A0A7N5JE15_BCL2L11      ----------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQ
A0A7N5JE15_BCL2L11      LSKEHIKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQ
A0A7N5JE15_BCL2L11      ----------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQ
A0A7N5JE15_BCL2L11      --KGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQ
A0A7N5JE15_BCL2L11      GLRNARKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQ
                                  ****************************************

A0A7N5JE15_BCL2L11      Q-------------------------------------------------
A0A7N5JE15_BCL2L11      Q-------------------------------------------------
A0A7N5JE15_BCL2L11      QGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSS
A0A7N5JE15_BCL2L11      Q-------------------------------------------------
A0A7N5JE15_BCL2L11      QGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSS
A0A7N5JE15_BCL2L11      Q-------------------------------------------------
A0A7N5JE15_BCL2L11      Q-------------------------------------------------
                        *                                                 

A0A7N5JE15_BCL2L11      -------------------------------------ASMRQSQAVPADM
A0A7N5JE15_BCL2L11      -------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADM
A0A7N5JE15_BCL2L11      GYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADM
A0A7N5JE15_BCL2L11      -------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADM
A0A7N5JE15_BCL2L11      GYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADM
A0A7N5JE15_BCL2L11      -------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADM
A0A7N5JE15_BCL2L11      -------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADM
                                                             *************

A0A7N5JE15_BCL2L11      RPEIWIAQELRRIGDEFNAYYPR---------------------------
A0A7N5JE15_BCL2L11      RPEIWIAQELRRIGDEFNAYYPRRGLVAAGAADSGLPRIAPETCGPWQRH
A0A7N5JE15_BCL2L11      RPEIWIAQELRRIGDEFNAYYPR---------------------------
A0A7N5JE15_BCL2L11      RPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQM-----------
A0A7N5JE15_BCL2L11      RPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQM-----------
A0A7N5JE15_BCL2L11      RPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQM-----------
A0A7N5JE15_BCL2L11      RPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQM-----------
                        ***********************                           

A0A7N5JE15_BCL2L11      ---------------------------------------------RLARI
A0A7N5JE15_BCL2L11      GIKCTSPGRNVLKDSAQSGTFCLSKLCCSCKMFNPHLFPPVSLRWHWHSR
A0A7N5JE15_BCL2L11      ---------------------------------------------RLEQ-
A0A7N5JE15_BCL2L11      -------------------------------IILRLLRYIVRLVWRLQ--
A0A7N5JE15_BCL2L11      -------------------------------IILRLLRYIVRLVWRLQR-
A0A7N5JE15_BCL2L11      -------------------------------IILRLLRYIVRLVWRLQ--
A0A7N5JE15_BCL2L11      -------------------------------IILRLLRYIVRLVWRLQ--
                                                                     .    

A0A7N5JE15_BCL2L11      PASYLC
A0A7N5JE15_BCL2L11      LLPNLG
A0A7N5JE15_BCL2L11      ------
A0A7N5JE15_BCL2L11      ------
A0A7N5JE15_BCL2L11      ------
A0A7N5JE15_BCL2L11      ------
A0A7N5JE15_BCL2L11      ------
                              

© 1998-2022Legal notice